Protein Family IF08359
Metagenome
Isolate
266
Members
46
Samples
259
Scaffolds
480.5
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_461313|Ga0466726_461313_2776_4362
- Length
- 528 aa
- Sequence
- LTNFHNRSIKFKFSEYIGKDTSSTMRSRRQGSDFSGIIGSPMLYSTGRSMRIVIVGAGLVGTQLARHLVQEKHDVSLIESNEERAQHVSNRLDCLVLHDEGNNLSSLKEAGIAKADALVCVTDSDEVNMIICGLAASRYPKLLKIARVRNDDYVRLNQAGEGVFEDRHILGIDHFVHPDVEASRSVLSALAHGAIGNILTFAGTPYELGSIDIAAGSSFDGLSLKDYRSLIKEESLVTLVERKGESLLPTGSTTLVKEDRIHILAQEAEMEHIFKLAGRTEKPLRRIGIVGGSRIGALIAGGLLGKDLESGGKRKKRGFFSLFKSFMPKSSRRVVIIEQNHEVCQDLAARFPDALILNEDISDESFVAEEQIGNLDLIITATDNQELNMIAALYLKSRGVRRAIALVSGSGYEAIARRLGVDVVIPMKSVVVDSILSHLLRGGIKGVHRIGDGSVGIIEIEIGSASPVAETPITAFRLAAGGLVMLVNREGGSFIPRGDYVFKAGDKIVMIAKNGGEAEIERFFGPSK
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
31.8%
Termitidae
29.5%
Unclassified
18.2%
Rhinotermitidae
9.1%
Termopsidae
6.8%
Blaberidae
2.3%
Hodotermitidae
2.3%
Taxonomy
Archaea
1
Bacteria
256
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 2 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 3 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 26 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 39 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 40 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 46 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_232937 | 3300042612 | Bacteria | 4409 |
| 2 | Ga0466705_238483 | 3300042612 | Bacteria | 5545 |
| 3 | Ga0466711_282742 | 3300042615 | Bacteria | 9728 |
| 4 | Ga0466715_400284 | 3300042616 | Bacteria | 7969 |
| 5 | Ga0466715_607526 | 3300042616 | Bacteria | 3276 |
| 6 | Ga0466718_095132 | 3300042617 | Bacteria | 2810 |
| 7 | Ga0466726_100384 | 3300042619 | Bacteria | 4119 |
| 8 | Ga0466728_102121 | 3300042620 | Bacteria | 5147 |
| 9 | Ga0466703_159270 | 3300042636 | Bacteria | 6694 |
| 10 | Ga0466704_034939 | 3300042643 | Bacteria | 3950 |
| 11 | Ga0466704_063908 | 3300042643 | Bacteria | 11517 |
| 12 | Ga0466704_143769 | 3300042643 | Bacteria | 8015 |
| 13 | Ga0466704_184050 | 3300042643 | Bacteria | 12086 |
| 14 | Ga0466704_417160 | 3300042643 | Bacteria | 44433 |
| 15 | Ga0466709_399779 | 3300042648 | Bacteria | 7198 |
| 16 | Ga0466708_240405 | 3300042652 | Bacteria | 15347 |
| 17 | Ga0466727_026432 | 3300042655 | Bacteria | 1894 |
| 18 | Ga0264413_104295 | 3300024493 | Bacteria | 13231 |
| 19 | Ga0466694_282157 | 3300042594 | Bacteria | 2268 |
| 20 | Ga0466696_355271 | 3300042596 | Bacteria | 15179 |
| 21 | JGI24702J35022_10002662 | 3300002462 | Bacteria | 10841 |
| 22 | JGI24702J35022_10082180 | 3300002462 | Bacteria | 1746 |
| 23 | Ga0466707_307159 | 3300042601 | Bacteria | 2206 |
| 24 | Ga0466707_336922 | 3300042601 | Bacteria | 5061 |
| 25 | Ga0466713_152309 | 3300042602 | Bacteria | 11166 |
| 26 | Ga0466719_011256 | 3300042606 | Bacteria | 20714 |
| 27 | Ga0466722_122335 | 3300042609 | Bacteria | 8901 |
| 28 | Ga0466722_249615 | 3300042609 | Bacteria | 3475 |
| 29 | Ga0466705_092551 | 3300042612 | Bacteria | 26948 |
| 30 | Ga0466733_084155 | 3300042659 | Bacteria | 2189 |
| 31 | Ga0466712_135420 | 3300042614 | Bacteria | 9445 |
| 32 | Ga0466712_190464 | 3300042614 | Bacteria | 1679 |
| 33 | Ga0466711_105339 | 3300042615 | Bacteria | 3565 |
| 34 | Ga0466711_166599 | 3300042615 | Bacteria | 3057 |
| 35 | Ga0466715_053606 | 3300042616 | Bacteria | 33406 |
| 36 | Ga0466715_413134 | 3300042616 | Bacteria | 19075 |
| 37 | Ga0466723_040010 | 3300042618 | Bacteria | 44504 |
| 38 | Ga0466723_070031 | 3300042618 | Bacteria | 39681 |
| 39 | Ga0466723_087526 | 3300042618 | Bacteria | 41096 |
| 40 | Ga0466726_461313 | 3300042619 | Bacteria | 7792 |
| 41 | Ga0466726_496945 | 3300042619 | Bacteria | 4087 |
| 42 | Ga0466728_027217 | 3300042620 | Bacteria | 10322 |
| 43 | Ga0466728_202353 | 3300042620 | Bacteria | 4509 |
| 44 | Ga0466735_058527 | 3300042624 | Bacteria | 7906 |
| 45 | Ga0466703_060055 | 3300042636 | Bacteria | 2670 |
| 46 | Ga0466703_299029 | 3300042636 | Bacteria | 12030 |
| 47 | Ga0466704_298844 | 3300042643 | Bacteria | 16621 |
| 48 | Ga0466709_026535 | 3300042648 | Bacteria | 2125 |
| 49 | Ga0466709_029755 | 3300042648 | Bacteria | 3318 |
| 50 | Ga0466708_055023 | 3300042652 | Unclassified | 9208 |
| 51 | Ga0466708_139854 | 3300042652 | Bacteria | 13083 |
| 52 | Ga0466708_319853 | 3300042652 | Bacteria | 28593 |
| 53 | Ga0466690_323153 | 3300042590 | Bacteria | 1421 |
| 54 | Ga0466691_001820 | 3300042593 | Bacteria | 8252 |
| 55 | Ga0466691_014585 | 3300042593 | Bacteria | 20179 |
| 56 | Ga0466691_106306 | 3300042593 | Bacteria | 5517 |
| 57 | Ga0466691_150363 | 3300042593 | Bacteria | 5532 |
| 58 | Ga0466691_215274 | 3300042593 | Bacteria | 11746 |
| 59 | Ga0466696_081933 | 3300042596 | Bacteria | 7411 |
| 60 | Ga0466696_092453 | 3300042596 | Bacteria | 7949 |
| 61 | Ga0072941_1027745 | 3300005201 | Bacteria | 14028 |
| 62 | Ga0466716_087598 | 3300042605 | Bacteria | 19401 |
| 63 | Ga0466716_499666 | 3300042605 | Bacteria | 11661 |
| 64 | Ga0466722_105519 | 3300042609 | Bacteria | 14051 |
| 65 | Ga0466733_192306 | 3300042659 | Bacteria | 35939 |
| 66 | Ga0123357_10012372 | 3300009784 | Bacteria | 11005 |
| 67 | Ga0466711_090684 | 3300042615 | Bacteria | 2257 |
| 68 | Ga0466711_503189 | 3300042615 | Bacteria | 26467 |
| 69 | Ga0466715_172156 | 3300042616 | Bacteria | 14803 |
| 70 | Ga0466715_361542 | 3300042616 | Bacteria | 8478 |
| 71 | Ga0466715_562031 | 3300042616 | Bacteria | 10967 |
| 72 | Ga0466715_638956 | 3300042616 | Bacteria | 23246 |
| 73 | Ga0466723_073577 | 3300042618 | Bacteria | 4476 |
| 74 | Ga0466723_125740 | 3300042618 | Bacteria | 1968 |
| 75 | Ga0466726_345814 | 3300042619 | Bacteria | 6489 |
| 76 | Ga0466728_048413 | 3300042620 | Bacteria | 3499 |
| 77 | Ga0466735_009476 | 3300042624 | Bacteria | 12609 |
| 78 | Ga0466703_022004 | 3300042636 | Bacteria | 8683 |
| 79 | Ga0466703_179954 | 3300042636 | Bacteria | 9089 |
| 80 | Ga0466703_388582 | 3300042636 | Bacteria | 16269 |
| 81 | Ga0466704_069475 | 3300042643 | Unclassified | 4754 |
| 82 | Ga0466704_451301 | 3300042643 | Bacteria | 35296 |
| 83 | Ga0466709_412165 | 3300042648 | Bacteria | 14124 |
| 84 | Ga0456237_0001717 | 3300041968 | Bacteria | 3515 |
| 85 | Ga0466690_082253 | 3300042590 | Bacteria | 4626 |
| 86 | Ga0466692_136302 | 3300042591 | Bacteria | 8801 |
| 87 | Ga0466691_135908 | 3300042593 | Bacteria | 4509 |
| 88 | Ga0466694_308160 | 3300042594 | Bacteria | 6881 |
| 89 | Ga0466695_011439 | 3300042595 | Unclassified | 10613 |
| 90 | Ga0466696_038985 | 3300042596 | Bacteria | 15563 |
| 91 | JGI24698J34947_10000579 | 3300002449 | Unclassified | 17427 |
| 92 | Ga0466706_041431 | 3300042599 | Bacteria | 39815 |
| 93 | Ga0466716_025036 | 3300042605 | Bacteria | 32309 |
| 94 | Ga0466716_361660 | 3300042605 | Bacteria | 8267 |
| 95 | Ga0466722_059803 | 3300042609 | Bacteria | 24916 |
| 96 | Ga0466722_068601 | 3300042609 | Archaea | 8995 |
| 97 | Ga0466722_094529 | 3300042609 | Bacteria | 4803 |
| 98 | Ga0466722_197203 | 3300042609 | Bacteria | 21912 |
| 99 | Ga0466705_032291 | 3300042612 | Bacteria | 8860 |
| 100 | Ga0466705_235847 | 3300042612 | Bacteria | 9994 |
| 101 | Ga0466711_045693 | 3300042615 | Bacteria | 10690 |
| 102 | Ga0466718_047067 | 3300042617 | Bacteria | 2240 |
| 103 | Ga0466718_051140 | 3300042617 | Bacteria | 10180 |
| 104 | Ga0466723_034656 | 3300042618 | Bacteria | 8567 |
| 105 | Ga0466723_186611 | 3300042618 | Bacteria | 4814 |
| 106 | Ga0466723_222126 | 3300042618 | Bacteria | 4003 |
| 107 | Ga0466726_333939 | 3300042619 | Bacteria | 6822 |
| 108 | Ga0466728_102604 | 3300042620 | Bacteria | 28363 |
| 109 | Ga0466728_437437 | 3300042620 | Bacteria | 10016 |
| 110 | Ga0466703_049535 | 3300042636 | Bacteria | 6935 |
| 111 | Ga0466704_153879 | 3300042643 | Bacteria | 3587 |
| 112 | Ga0466704_345636 | 3300042643 | Bacteria | 6764 |
| 113 | Ga0466709_208096 | 3300042648 | Bacteria | 3008 |
| 114 | Ga0466709_297213 | 3300042648 | Bacteria | 8676 |
| 115 | Ga0466709_362903 | 3300042648 | Bacteria | 3946 |
| 116 | Ga0466709_378292 | 3300042648 | Bacteria | 18499 |
| 117 | Ga0466708_406080 | 3300042652 | Bacteria | 2944 |
| 118 | Ga0466727_302710 | 3300042655 | Bacteria | 4727 |
| 119 | Ga0264413_113565 | 3300024493 | Unclassified | 6803 |
| 120 | Ga0456237_0003461 | 3300041968 | Bacteria | 2553 |
| 121 | Ga0466691_056725 | 3300042593 | Bacteria | 6881 |
| 122 | Ga0466694_078502 | 3300042594 | Bacteria | 33638 |
| 123 | Ga0466696_191168 | 3300042596 | Bacteria | 2542 |
| 124 | JGI24698J34947_10003351 | 3300002449 | Unclassified | 8696 |
| 125 | Ga0072941_1022423 | 3300005201 | Bacteria | 13107 |
| 126 | Ga0466707_109272 | 3300042601 | Bacteria | 3035 |
| 127 | Ga0466713_146482 | 3300042602 | Bacteria | 5692 |
| 128 | Ga0466719_213809 | 3300042606 | Bacteria | 7756 |
| 129 | Ga0466719_468397 | 3300042606 | Bacteria | 2715 |
| 130 | Ga0466722_022751 | 3300042609 | Bacteria | 6400 |
| 131 | Ga0466722_081254 | 3300042609 | Bacteria | 3679 |
| 132 | Ga0466705_068364 | 3300042612 | Bacteria | 2280 |
| 133 | Ga0466705_278100 | 3300042612 | Bacteria | 7173 |
| 134 | Ga0466711_066814 | 3300042615 | Bacteria | 6464 |
| 135 | Ga0466711_148713 | 3300042615 | Bacteria | 23029 |
| 136 | Ga0466715_209331 | 3300042616 | Bacteria | 2374 |
| 137 | Ga0466715_268559 | 3300042616 | Bacteria | 12449 |
| 138 | Ga0466723_045995 | 3300042618 | Bacteria | 7367 |
| 139 | Ga0466723_085894 | 3300042618 | Bacteria | 3032 |
| 140 | Ga0466723_198838 | 3300042618 | Bacteria | 7139 |
| 141 | Ga0466723_328840 | 3300042618 | Bacteria | 2834 |
| 142 | Ga0466726_019071 | 3300042619 | Bacteria | 2535 |
| 143 | Ga0466726_187761 | 3300042619 | Bacteria | 3939 |
| 144 | Ga0466728_058687 | 3300042620 | Bacteria | 7266 |
| 145 | Ga0466735_138819 | 3300042624 | Bacteria | 3182 |
| 146 | Ga0466703_006357 | 3300042636 | Bacteria | 3803 |
| 147 | Ga0466703_021203 | 3300042636 | Bacteria | 13619 |
| 148 | Ga0466703_141290 | 3300042636 | Bacteria | 4047 |
| 149 | Ga0466704_032135 | 3300042643 | Bacteria | 3576 |
| 150 | Ga0466704_120227 | 3300042643 | Bacteria | 3453 |
| 151 | Ga0466709_011063 | 3300042648 | Bacteria | 5963 |
| 152 | Ga0466709_030013 | 3300042648 | Bacteria | 4942 |
| 153 | Ga0466708_210571 | 3300042652 | Bacteria | 6198 |
| 154 | Ga0466708_384397 | 3300042652 | Bacteria | 13623 |
| 155 | Ga0466696_064391 | 3300042596 | Bacteria | 8814 |
| 156 | Ga0466696_273723 | 3300042596 | Bacteria | 3130 |
| 157 | Ga0466696_461735 | 3300042596 | Bacteria | 6280 |
| 158 | JGI24698J34947_10010605 | 3300002449 | Bacteria | 5057 |
| 159 | JGI24698J34947_10025618 | 3300002449 | Bacteria | 3138 |
| 160 | Ga0072941_1041320 | 3300005201 | Bacteria | 6628 |
| 161 | Ga0466713_036161 | 3300042602 | Bacteria | 2833 |
| 162 | Ga0466716_029927 | 3300042605 | Bacteria | 1802 |
| 163 | Ga0466716_441128 | 3300042605 | Bacteria | 4959 |
| 164 | Ga0466722_180057 | 3300042609 | Bacteria | 6406 |
| 165 | Ga0466705_016260 | 3300042612 | Bacteria | 6874 |
| 166 | Ga0466705_050742 | 3300042612 | Bacteria | 5197 |
| 167 | Ga0466733_013232 | 3300042659 | Bacteria | 48535 |
| 168 | Ga0466712_039345 | 3300042614 | Bacteria | 10033 |
| 169 | Ga0466711_198182 | 3300042615 | Bacteria | 9899 |
| 170 | Ga0466715_471521 | 3300042616 | Bacteria | 6830 |
| 171 | Ga0466723_355947 | 3300042618 | Bacteria | 3143 |
| 172 | Ga0466726_339717 | 3300042619 | Bacteria | 4593 |
| 173 | Ga0466728_003085 | 3300042620 | Bacteria | 7971 |
| 174 | Ga0466731_125328 | 3300042622 | Bacteria | 46638 |
| 175 | Ga0466708_020168 | 3300042652 | Bacteria | 15379 |
| 176 | Ga0466708_051212 | 3300042652 | Bacteria | 6986 |
| 177 | Ga0466708_061446 | 3300042652 | Bacteria | 7346 |
| 178 | Ga0466727_214135 | 3300042655 | Bacteria | 5570 |
| 179 | Ga0466727_333485 | 3300042655 | Bacteria | 10337 |
| 180 | Ga0466690_024336 | 3300042590 | Bacteria | 2162 |
| 181 | Ga0466692_074349 | 3300042591 | Bacteria | 33582 |
| 182 | Ga0466691_040707 | 3300042593 | Bacteria | 19518 |
| 183 | Ga0466691_045141 | 3300042593 | Bacteria | 21340 |
| 184 | Ga0466691_058210 | 3300042593 | Bacteria | 4962 |
| 185 | AustNasuHG_c1005792 | 3300000089 | Bacteria | 4413 |
| 186 | JGI24698J34947_10010292 | 3300002449 | Bacteria | 5128 |
| 187 | Ga0072941_1056366 | 3300005201 | Bacteria | 3145 |
| 188 | Ga0074263_108587 | 3300005485 | Bacteria | 2201 |
| 189 | Ga0466707_078174 | 3300042601 | Bacteria | 1510 |
| 190 | Ga0466707_223287 | 3300042601 | Bacteria | 1734 |
| 191 | Ga0466713_073560 | 3300042602 | Bacteria | 20098 |
| 192 | Ga0466719_260373 | 3300042606 | Bacteria | 26617 |
| 193 | Ga0466722_190345 | 3300042609 | Bacteria | 3530 |
| 194 | Ga0123357_10267226 | 3300009784 | Bacteria | 1795 |
| 195 | Ga0123354_10023233 | 3300010882 | Bacteria | 9778 |
| 196 | Ga0466712_115080 | 3300042614 | Bacteria | 5750 |
| 197 | Ga0466712_292770 | 3300042614 | Bacteria | 4488 |
| 198 | Ga0466711_506240 | 3300042615 | Bacteria | 7990 |
| 199 | Ga0466715_618236 | 3300042616 | Bacteria | 19913 |
| 200 | Ga0466718_028562 | 3300042617 | Bacteria | 9741 |
| 201 | Ga0466723_091707 | 3300042618 | Bacteria | 9321 |
| 202 | Ga0466723_203170 | 3300042618 | Bacteria | 8235 |
| 203 | Ga0466723_324799 | 3300042618 | Bacteria | 8065 |
| 204 | Ga0466726_090170 | 3300042619 | Bacteria | 5502 |
| 205 | Ga0466726_379510 | 3300042619 | Bacteria | 21789 |
| 206 | Ga0466726_431672 | 3300042619 | Bacteria | 3072 |
| 207 | Ga0466728_331738 | 3300042620 | Bacteria | 6027 |
| 208 | Ga0466735_060281 | 3300042624 | Bacteria | 19223 |
| 209 | Ga0466703_320959 | 3300042636 | Bacteria | 4986 |
| 210 | Ga0466703_367241 | 3300042636 | Bacteria | 2845 |
| 211 | Ga0466709_196245 | 3300042648 | Bacteria | 8436 |
| 212 | Ga0466708_035723 | 3300042652 | Bacteria | 2137 |
| 213 | Ga0466727_041180 | 3300042655 | Bacteria | 2116 |
| 214 | Ga0466690_054270 | 3300042590 | Bacteria | 5489 |
| 215 | Ga0466690_185621 | 3300042590 | Bacteria | 6663 |
| 216 | Ga0466690_313767 | 3300042590 | Bacteria | 2438 |
| 217 | Ga0466692_012676 | 3300042591 | Bacteria | 7899 |
| 218 | Ga0466692_036694 | 3300042591 | Bacteria | 15700 |
| 219 | Ga0466692_159000 | 3300042591 | Bacteria | 27397 |
| 220 | Ga0466691_167388 | 3300042593 | Bacteria | 6591 |
| 221 | JGI24698J34947_10002996 | 3300002449 | Bacteria | 9159 |
| 222 | Ga0466719_198585 | 3300042606 | Bacteria | 5409 |
| 223 | Ga0466719_421406 | 3300042606 | Bacteria | 13928 |
| 224 | Ga0466722_071404 | 3300042609 | Bacteria | 4000 |
| 225 | Ga0466722_152577 | 3300042609 | Bacteria | 11986 |
| 226 | Ga0466732_447088 | 3300042656 | Bacteria | 4091 |
| 227 | Ga0466733_083780 | 3300042659 | Bacteria | 18215 |
| 228 | Ga0466712_033514 | 3300042614 | Bacteria | 5408 |
| 229 | Ga0466712_069750 | 3300042614 | Bacteria | 13499 |
| 230 | Ga0466712_239387 | 3300042614 | Bacteria | 10434 |
| 231 | Ga0466711_043981 | 3300042615 | Bacteria | 9128 |
| 232 | Ga0466711_072963 | 3300042615 | Bacteria | 14035 |
| 233 | Ga0466711_247619 | 3300042615 | Bacteria | 8318 |
| 234 | Ga0466723_110108 | 3300042618 | Bacteria | 11677 |
| 235 | Ga0466723_278010 | 3300042618 | Bacteria | 4206 |
| 236 | Ga0466728_003254 | 3300042620 | Bacteria | 5099 |
| 237 | Ga0466728_126273 | 3300042620 | Bacteria | 19096 |
| 238 | Ga0466728_246077 | 3300042620 | Bacteria | 2591 |
| 239 | Ga0466729_208837 | 3300042621 | Bacteria | 3164 |
| 240 | Ga0466731_295533 | 3300042622 | Bacteria | 2314 |
| 241 | Ga0466703_087881 | 3300042636 | Bacteria | 18993 |
| 242 | Ga0466704_613420 | 3300042643 | Bacteria | 3549 |
| 243 | Ga0466709_156595 | 3300042648 | Bacteria | 14157 |
| 244 | Ga0466708_063529 | 3300042652 | Bacteria | 3192 |
| 245 | Ga0466708_436161 | 3300042652 | Bacteria | 8108 |
| 246 | Ga0466727_187400 | 3300042655 | Bacteria | 4535 |
| 247 | Ga0466692_192425 | 3300042591 | Bacteria | 4591 |
| 248 | Ga0466691_023909 | 3300042593 | Bacteria | 13162 |
| 249 | Ga0466694_081447 | 3300042594 | Bacteria | 6997 |
| 250 | Ga0466696_162461 | 3300042596 | Unclassified | 3787 |
| 251 | AustNasuHG_c1016653 | 3300000089 | Unclassified | 2454 |
| 252 | JGI24702J35022_10014631 | 3300002462 | Bacteria | 4324 |
| 253 | Ga0072941_1066469 | 3300005201 | Bacteria | 7485 |
| 254 | Ga0466716_120032 | 3300042605 | Bacteria | 5892 |
| 255 | Ga0466716_186536 | 3300042605 | Bacteria | 4462 |
| 256 | Ga0466716_218418 | 3300042605 | Bacteria | 3760 |
| 257 | Ga0466719_340159 | 3300042606 | Bacteria | 10808 |
| 258 | Ga0466722_199676 | 3300042609 | Bacteria | 2875 |
| 259 | Ga0466722_251366 | 3300042609 | Unclassified | 4153 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02080 | TrkA_C | TrkA-C domain | 458 | 525 | 0.96 |
| PF01266 | DAO | FAD dependent oxidoreductase | 51 | 91 | 0.94 |
| PF02254 | TrkA_N | TrkA-N domain | 332 | 425 | 0.94 |
| PF01488 | Shikimate_DH | Shikimate / quinate 5-dehydrogenase | 49 | 126 | 0.84 |
| PF13241 | NAD_binding_7 | Putative NAD(P)-binding | 49 | 137 | 0.74 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02254 | GO:0006813 | potassium ion transport | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.