Protein Family IF08340
Metagenome
Isolate
219
Members
71
Samples
204
Scaffolds
253.35
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_398105|Ga0466726_398105_10299_11138
- Length
- 279 aa
- Sequence
- MNNGTRQPKAVIEKEELLTLFTKIRQGEITPEEALLRVQTAPFEDLGYAKIDLHRGARQGVSEVVYGQHKTPGQILGIVSAMRGKGLSNILLTRLSDAAASYLTANGIDLEYHPIPRLGVVCRASTDASVDAPYGSIVVASAGTSDMAVCEEAALTAELFGSRVTRLYDVGVAGLHRLLARLDVLSAARVVIAVAGMEGALASVIGGLVSCPVIAVPTSVGYGANFAGLSALLSMLNSCASGVAVVNIDNGFGAGYIANVINKIRSAQDGGADPSEDQS
Sample Types
Isolate
6.8%
Metagenome
93.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.6%
Unclassified
21.7%
Kalotermitidae
20.3%
Termopsidae
5.8%
Rhinotermitidae
2.9%
Passalidae
2.9%
Hodotermitidae
1.4%
Elmidae
1.4%
Culicidae
1.4%
Blattidae
1.4%
Taxonomy
Archaea
2
Bacteria
197
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 2 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 3 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 44 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 45 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 46 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 47 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 48 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 52 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 53 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 54 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 55 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 56 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 57 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 58 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 59 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 60 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 61 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 62 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 63 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 64 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 65 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 66 | 2778260939 | Unclassified Fibrobacteres Co191P4bin13 | Isolate | Unclassified |
| 67 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 68 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 69 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 70 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 71 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_023773 | 3300042601 | Bacteria | 3209 |
| 2 | Ga0466702_352630 | 3300042635 | Bacteria | 1902 |
| 3 | Ga0466727_084148 | 3300042655 | Bacteria | 121095 |
| 4 | Ga0466727_090836 | 3300042655 | Bacteria | 1493 |
| 5 | Ga0466727_148553 | 3300042655 | Bacteria | 1697 |
| 6 | Ga0466727_150924 | 3300042655 | Bacteria | 116830 |
| 7 | Ga0466712_162461 | 3300042614 | Bacteria | 25933 |
| 8 | Ga0466715_322807 | 3300042616 | Bacteria | 3312 |
| 9 | Ga0466718_018787 | 3300042617 | Unclassified | 3343 |
| 10 | Ga0466718_161252 | 3300042617 | Bacteria | 1309 |
| 11 | Ga0466726_217236 | 3300042619 | Bacteria | 220873 |
| 12 | Ga0123355_10385206 | 3300009826 | Bacteria | 1823 |
| 13 | Ga0123353_10003516 | 3300010167 | Bacteria | 19821 |
| 14 | IMNBL1DRAFT_c0016018 | 3300000062 | Unclassified | 3226 |
| 15 | JGI24698J34947_10046231 | 3300002449 | Bacteria | 2216 |
| 16 | JGI24702J35022_10004182 | 3300002462 | Bacteria | 8618 |
| 17 | Ga0068305_10000874 | 3300005083 | Bacteria | 29431 |
| 18 | Ga0072941_1004046 | 3300005201 | Bacteria | 45352 |
| 19 | Ga0072941_1067385 | 3300005201 | Bacteria | 15269 |
| 20 | Ga0072941_1249226 | 3300005201 | Bacteria | 1205 |
| 21 | Ga0466706_004548 | 3300042599 | Bacteria | 42399 |
| 22 | Ga0466706_201378 | 3300042599 | Bacteria | 153801 |
| 23 | Ga0466707_102983 | 3300042601 | Bacteria | 37658 |
| 24 | Ga0466707_343493 | 3300042601 | Bacteria | 38851 |
| 25 | Ga0466714_039435 | 3300042603 | Bacteria | 5561 |
| 26 | Ga0466717_103477 | 3300042604 | Bacteria | 6637 |
| 27 | Ga0466719_373532 | 3300042606 | Bacteria | 11756 |
| 28 | Ga0466720_238637 | 3300042607 | Bacteria | 4531 |
| 29 | Ga0466698_450067 | 3300042610 | Bacteria | 1714 |
| 30 | Ga0466704_263964 | 3300042643 | Bacteria | 3235 |
| 31 | Ga0466727_041865 | 3300042655 | Bacteria | 123201 |
| 32 | Ga0466711_006581 | 3300042615 | Bacteria | 37124 |
| 33 | Ga0466711_139323 | 3300042615 | Bacteria | 40126 |
| 34 | Ga0466715_276530 | 3300042616 | Bacteria | 26521 |
| 35 | Ga0466718_124840 | 3300042617 | Bacteria | 2410 |
| 36 | Ga0466723_322192 | 3300042618 | Bacteria | 41479 |
| 37 | Ga0466726_118683 | 3300042619 | Unclassified | 3589 |
| 38 | Ga0466726_166854 | 3300042619 | Bacteria | 14683 |
| 39 | Ga0466726_309603 | 3300042619 | Archaea | 7250 |
| 40 | Ga0466726_444494 | 3300042619 | Unclassified | 3732 |
| 41 | Ga0466728_341607 | 3300042620 | Bacteria | 1664 |
| 42 | Ga0466729_101464 | 3300042621 | Unclassified | 2695 |
| 43 | Ga0415639_008150 | 3300038395 | Bacteria | 32743 |
| 44 | Ga0466690_001780 | 3300042590 | Bacteria | 34391 |
| 45 | Ga0466691_064850 | 3300042593 | Bacteria | 16118 |
| 46 | Ga0466691_213616 | 3300042593 | Bacteria | 1373 |
| 47 | Ga0466694_057187 | 3300042594 | Bacteria | 39446 |
| 48 | Ga0466694_149164 | 3300042594 | Bacteria | 23932 |
| 49 | Ga0466694_173402 | 3300042594 | Bacteria | 3699 |
| 50 | Ga0123355_10015648 | 3300009826 | Bacteria | 11927 |
| 51 | Ga0123355_10033503 | 3300009826 | Bacteria | 8344 |
| 52 | Ga0123356_10329109 | 3300010049 | Bacteria | 1644 |
| 53 | Ga0123353_10434890 | 3300010167 | Archaea | 1938 |
| 54 | Ga0123353_10543378 | 3300010167 | Bacteria | 1678 |
| 55 | Ga0123353_10601931 | 3300010167 | Bacteria | 1571 |
| 56 | Ga0123353_10926034 | 3300010167 | Bacteria | 1183 |
| 57 | JGI24695J34938_10001046 | 3300002450 | Unclassified | 25090 |
| 58 | JGI24700J35501_10929706 | 3300002508 | Bacteria | 9896 |
| 59 | JGI24696J40584_12959334 | 3300002834 | Bacteria | 4997 |
| 60 | Ga0068305_10000886 | 3300005083 | Bacteria | 103801 |
| 61 | Ga0072940_1001247 | 3300005200 | Bacteria | 3030 |
| 62 | Ga0072940_1018102 | 3300005200 | Bacteria | 2140 |
| 63 | Ga0466713_011752 | 3300042602 | Bacteria | 44620 |
| 64 | Ga0466713_056585 | 3300042602 | Bacteria | 30523 |
| 65 | Ga0466716_209896 | 3300042605 | Bacteria | 12981 |
| 66 | Ga0466719_354280 | 3300042606 | Bacteria | 3354 |
| 67 | Ga0466722_184615 | 3300042609 | Bacteria | 8069 |
| 68 | Ga0466702_030254 | 3300042635 | Bacteria | 4625 |
| 69 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 70 | Ga0466704_123592 | 3300042643 | Bacteria | 55096 |
| 71 | Ga0466710_021228 | 3300042613 | Bacteria | 41506 |
| 72 | Ga0466712_102662 | 3300042614 | Bacteria | 1192 |
| 73 | Ga0466723_075284 | 3300042618 | Bacteria | 10946 |
| 74 | Ga0466726_344866 | 3300042619 | Bacteria | 3111 |
| 75 | Ga0466728_105509 | 3300042620 | Bacteria | 43729 |
| 76 | Ga0466693_000689 | 3300042592 | Bacteria | 5196 |
| 77 | Ga0466691_094025 | 3300042593 | Bacteria | 4432 |
| 78 | Ga0123357_10460927 | 3300009784 | Bacteria | 1093 |
| 79 | Ga0123355_10023396 | 3300009826 | Bacteria | 9923 |
| 80 | Ga0123356_10009942 | 3300010049 | Bacteria | 9366 |
| 81 | Ga0123353_10248647 | 3300010167 | Bacteria | 2756 |
| 82 | Ga0123353_10370031 | 3300010167 | Bacteria | 2149 |
| 83 | Ga0123353_10582062 | 3300010167 | Bacteria | 1605 |
| 84 | JGI24698J34947_10000111 | 3300002449 | Bacteria | 28366 |
| 85 | JGI24695J34938_10094737 | 3300002450 | Bacteria | 1223 |
| 86 | Ga0072941_1013877 | 3300005201 | Unclassified | 24626 |
| 87 | Ga0072941_1016260 | 3300005201 | Bacteria | 26281 |
| 88 | Ga0466713_060358 | 3300042602 | Bacteria | 76386 |
| 89 | Ga0466722_248021 | 3300042609 | Bacteria | 24248 |
| 90 | Ga0466731_226095 | 3300042622 | Bacteria | 14920 |
| 91 | Ga0466703_297849 | 3300042636 | Bacteria | 43169 |
| 92 | Ga0466704_189815 | 3300042643 | Bacteria | 16259 |
| 93 | Ga0466704_596461 | 3300042643 | Bacteria | 93141 |
| 94 | Ga0466725_006313 | 3300042654 | Bacteria | 4265 |
| 95 | Ga0466711_206477 | 3300042615 | Bacteria | 1020 |
| 96 | Ga0466715_061157 | 3300042616 | Bacteria | 14827 |
| 97 | Ga0466715_240730 | 3300042616 | Bacteria | 70518 |
| 98 | Ga0466715_627388 | 3300042616 | Bacteria | 115089 |
| 99 | Ga0466718_012244 | 3300042617 | Bacteria | 10402 |
| 100 | Ga0466718_164519 | 3300042617 | Bacteria | 4496 |
| 101 | Ga0466723_219380 | 3300042618 | Bacteria | 16058 |
| 102 | Ga0466726_040454 | 3300042619 | Bacteria | 2278 |
| 103 | Ga0264413_119278 | 3300024493 | Unclassified | 2452 |
| 104 | Ga0466690_052731 | 3300042590 | Bacteria | 14113 |
| 105 | Ga0466693_078209 | 3300042592 | Bacteria | 15560 |
| 106 | Ga0466694_032721 | 3300042594 | Bacteria | 3030 |
| 107 | Ga0466696_170363 | 3300042596 | Bacteria | 3656 |
| 108 | Ga0123353_10058621 | 3300010167 | Bacteria | 6170 |
| 109 | Ga0123353_10497919 | 3300010167 | Bacteria | 1776 |
| 110 | Ga0123353_11122088 | 3300010167 | Bacteria | 1041 |
| 111 | 2227596853 | 2225789004 | Bacteria | 12648 |
| 112 | JGI24698J34947_10019452 | 3300002449 | Bacteria | 3661 |
| 113 | JGI24695J34938_10015014 | 3300002450 | Bacteria | 3990 |
| 114 | JGI24702J35022_10333945 | 3300002462 | Bacteria | 902 |
| 115 | Ga0072940_1021210 | 3300005200 | Bacteria | 6049 |
| 116 | Ga0466705_109930 | 3300042612 | Unclassified | 7496 |
| 117 | Ga0466719_524336 | 3300042606 | Bacteria | 382683 |
| 118 | Ga0466704_072859 | 3300042643 | Bacteria | 3504 |
| 119 | Ga0466704_230819 | 3300042643 | Unclassified | 15790 |
| 120 | Ga0466708_065015 | 3300042652 | Bacteria | 2799 |
| 121 | Ga0466711_261625 | 3300042615 | Bacteria | 6104 |
| 122 | Ga0466715_125251 | 3300042616 | Bacteria | 41475 |
| 123 | Ga0466723_305554 | 3300042618 | Bacteria | 2037 |
| 124 | Ga0123355_10014491 | 3300009826 | Bacteria | 12335 |
| 125 | Ga0123353_10018049 | 3300010167 | Bacteria | 10410 |
| 126 | Ga0123353_10084327 | 3300010167 | Bacteria | 5115 |
| 127 | Ga0123353_10230644 | 3300010167 | Bacteria | 2887 |
| 128 | Ga0160471_102044 | 3300012812 | Bacteria | 3540 |
| 129 | AustNasuHG_c1005551 | 3300000089 | Bacteria | 4508 |
| 130 | JGI24698J34947_10000842 | 3300002449 | Unclassified | 15401 |
| 131 | Ga0072940_1061205 | 3300005200 | Bacteria | 1508 |
| 132 | Ga0466706_218462 | 3300042599 | Bacteria | 2568 |
| 133 | Ga0466707_209080 | 3300042601 | Bacteria | 9297 |
| 134 | Ga0466716_312933 | 3300042605 | Bacteria | 15166 |
| 135 | Ga0466719_062453 | 3300042606 | Bacteria | 18088 |
| 136 | Ga0466719_126888 | 3300042606 | Unclassified | 19991 |
| 137 | Ga0466720_125154 | 3300042607 | Bacteria | 4297 |
| 138 | Ga0466735_205874 | 3300042624 | Bacteria | 4548 |
| 139 | Ga0466702_122522 | 3300042635 | Unclassified | 2499 |
| 140 | Ga0466712_009128 | 3300042614 | Bacteria | 18500 |
| 141 | Ga0466712_040275 | 3300042614 | Bacteria | 8694 |
| 142 | Ga0466712_207976 | 3300042614 | Bacteria | 10538 |
| 143 | Ga0466715_021845 | 3300042616 | Bacteria | 32348 |
| 144 | Ga0466715_117997 | 3300042616 | Unclassified | 13866 |
| 145 | Ga0466715_388582 | 3300042616 | Bacteria | 18317 |
| 146 | Ga0466723_313926 | 3300042618 | Bacteria | 15000 |
| 147 | Ga0466726_249471 | 3300042619 | Bacteria | 2325 |
| 148 | Ga0466726_285334 | 3300042619 | Bacteria | 3989 |
| 149 | Ga0466729_061040 | 3300042621 | Bacteria | 3951 |
| 150 | Ga0466691_225685 | 3300042593 | Bacteria | 109994 |
| 151 | Ga0123355_10001768 | 3300009826 | Bacteria | 30256 |
| 152 | Ga0123354_10207559 | 3300010882 | Bacteria | 2129 |
| 153 | JGI24698J34947_10000550 | 3300002449 | Bacteria | 17789 |
| 154 | Ga0123357_10002388 | 3300009784 | Bacteria | 20922 |
| 155 | Ga0466706_057588 | 3300042599 | Bacteria | 4063 |
| 156 | Ga0466707_417739 | 3300042601 | Bacteria | 9462 |
| 157 | Ga0466716_289779 | 3300042605 | Bacteria | 20915 |
| 158 | Ga0466719_007077 | 3300042606 | Unclassified | 15203 |
| 159 | Ga0466722_147052 | 3300042609 | Bacteria | 82065 |
| 160 | Ga0466702_441639 | 3300042635 | Bacteria | 3351 |
| 161 | Ga0466704_415603 | 3300042643 | Bacteria | 3511 |
| 162 | Ga0466712_149563 | 3300042614 | Bacteria | 12473 |
| 163 | Ga0466715_346322 | 3300042616 | Bacteria | 84028 |
| 164 | Ga0466715_614770 | 3300042616 | Bacteria | 11428 |
| 165 | Ga0466718_013271 | 3300042617 | Bacteria | 1989 |
| 166 | Ga0466718_037555 | 3300042617 | Bacteria | 1040 |
| 167 | Ga0466723_173627 | 3300042618 | Bacteria | 6527 |
| 168 | Ga0466728_306322 | 3300042620 | Bacteria | 70422 |
| 169 | Ga0466690_055751 | 3300042590 | Bacteria | 148091 |
| 170 | Ga0466696_058170 | 3300042596 | Unclassified | 39011 |
| 171 | Ga0466696_271787 | 3300042596 | Bacteria | 1874 |
| 172 | Ga0466699_007048 | 3300042597 | Bacteria | 2460 |
| 173 | Ga0123353_10190159 | 3300010167 | Bacteria | 3241 |
| 174 | Ga0123353_10195343 | 3300010167 | Bacteria | 3190 |
| 175 | Ga0123354_10144877 | 3300010882 | Bacteria | 2914 |
| 176 | JGI24698J34947_10000049 | 3300002449 | Bacteria | 34934 |
| 177 | Ga0068302_10004326 | 3300005071 | Unclassified | 9480 |
| 178 | Ga0466705_149033 | 3300042612 | Bacteria | 15839 |
| 179 | Ga0466705_263529 | 3300042612 | Bacteria | 1724 |
| 180 | Ga0466732_017156 | 3300042656 | Bacteria | 1917 |
| 181 | Ga0466707_079338 | 3300042601 | Bacteria | 13659 |
| 182 | Ga0466719_554262 | 3300042606 | Bacteria | 2661 |
| 183 | Ga0466729_301371 | 3300042621 | Bacteria | 6743 |
| 184 | Ga0466702_061851 | 3300042635 | Bacteria | 3699 |
| 185 | Ga0466709_209789 | 3300042648 | Unclassified | 19481 |
| 186 | Ga0466712_045449 | 3300042614 | Bacteria | 2509 |
| 187 | Ga0466711_261053 | 3300042615 | Bacteria | 39528 |
| 188 | Ga0466715_100290 | 3300042616 | Bacteria | 4019 |
| 189 | Ga0466718_018562 | 3300042617 | Bacteria | 22359 |
| 190 | Ga0466723_141836 | 3300042618 | Bacteria | 6196 |
| 191 | Ga0466726_398105 | 3300042619 | Bacteria | 17744 |
| 192 | Ga0466690_053851 | 3300042590 | Bacteria | 4036 |
| 193 | Ga0466690_215614 | 3300042590 | Unclassified | 8016 |
| 194 | Ga0466690_338573 | 3300042590 | Unclassified | 4756 |
| 195 | Ga0466691_213246 | 3300042593 | Bacteria | 5825 |
| 196 | Ga0466694_229388 | 3300042594 | Bacteria | 1585 |
| 197 | Ga0466699_171164 | 3300042597 | Bacteria | 22865 |
| 198 | Ga0123354_10179045 | 3300010882 | Bacteria | 2429 |
| 199 | JGI24695J34938_10005301 | 3300002450 | Bacteria | 8090 |
| 200 | JGI24695J34938_10006850 | 3300002450 | Bacteria | 6765 |
| 201 | Ga0068302_10011111 | 3300005071 | Bacteria | 5040 |
| 202 | Ga0068305_10000004 | 3300005083 | Bacteria | 52322 |
| 203 | Ga0068305_10000424 | 3300005083 | Bacteria | 48657 |
| 204 | Ga0072941_1016449 | 3300005201 | Bacteria | 37637 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00731 | AIRC | AIR carboxylase | 137 | 264 | 0.86 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00731 | GO:0006189 | 'de novo' IMP biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.