Protein Family IF08291
Metagenome
Isolate
279
Members
78
Samples
253
Scaffolds
486.45
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_281727|Ga0466726_281727_5036_6664
- Length
- 542 aa
- Sequence
- MCVFETVFASRREITNLICQICLQFVSNLFCEAQKPPLNRKKSLTLQPFSTKFSTLKKVMETIKFYSGEQFPLELHKVRVVQKLNLVPIERRLEALYEGGFNTFRLSTKDVFLDMLTDSGTNAMSDMQLSAMMHADDAYAGSQSFYRLLKAVQDVLRKQYFLPTHQGRAAENVLTKAYITKPGALVPTNYHFTTFLADVTMYGGRVVELLYDEAFNISSSHPFKGNMNVEKLDEVIRETGAENIPFIRMEASTNLIGGQPFSVENLRQVRRVADKYGIRLVLDASLLGENAYLVLQREKEFASSNMGEVIATMTGLADIVYFSARKLSSSRGGGICTSSEKISRELEALIPLFEGFLTYGGISVREIEAMAVGLYETLDESMICQSPSFIAYLVNGLVAKGVPMVTPAGVLGAHVDAMRMCAHIPQTQYPAGSLAAAFFLVSGVRGMERGSVSNQRDAEGNETYADMELLRLAVPRRVFTLSQIKYVEDRMKWLYDNRQLIGGLHFVYEPPVLRFFMGGMEPVSDWPKKLMAKFKADFGESL
Sample Types
Isolate
9.3%
Metagenome
90.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.5%
Unclassified
19.5%
Kalotermitidae
18.2%
Blattidae
14.3%
Rhinotermitidae
7.8%
Termopsidae
3.9%
Passalidae
2.6%
Hodotermitidae
1.3%
Taxonomy
Archaea
0
Bacteria
261
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 2 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 3 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 4 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 5 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 6 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 7 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 8 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 9 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 13 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 14 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 15 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 16 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 19 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 27 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 28 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 33 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 34 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 35 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 36 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 37 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 38 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 39 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 40 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 41 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 42 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 43 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 44 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 45 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 46 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 47 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 48 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 49 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 50 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 51 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 52 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 53 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 54 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 55 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 56 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 57 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 58 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 59 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 60 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 61 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 62 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 63 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 64 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 65 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 66 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 67 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 68 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 69 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 70 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 71 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 72 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 73 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 74 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 75 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 76 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 77 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 78 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_234097 | 3300042612 | Bacteria | 28349 |
| 2 | Ga0466732_318401 | 3300042656 | Bacteria | 83583 |
| 3 | Ga0466734_045724 | 3300042623 | Bacteria | 3398 |
| 4 | Ga0466730_063669 | 3300042625 | Bacteria | 4347 |
| 5 | Ga0466703_062668 | 3300042636 | Bacteria | 5475 |
| 6 | Ga0466703_073161 | 3300042636 | Bacteria | 6359 |
| 7 | Ga0466704_298469 | 3300042643 | Bacteria | 13889 |
| 8 | Ga0466708_129757 | 3300042652 | Bacteria | 16862 |
| 9 | Ga0466708_140192 | 3300042652 | Bacteria | 12348 |
| 10 | Ga0466727_223488 | 3300042655 | Bacteria | 8202 |
| 11 | Ga0466711_096104 | 3300042615 | Bacteria | 2480 |
| 12 | Ga0466715_084192 | 3300042616 | Bacteria | 39268 |
| 13 | Ga0466715_152522 | 3300042616 | Bacteria | 3581 |
| 14 | Ga0466715_500599 | 3300042616 | Bacteria | 7095 |
| 15 | Ga0466729_061813 | 3300042621 | Bacteria | 13331 |
| 16 | Ga0466657_011133 | 3300042582 | Bacteria | 16184 |
| 17 | Ga0466692_133437 | 3300042591 | Bacteria | 2544 |
| 18 | Ga0466691_087689 | 3300042593 | Bacteria | 15679 |
| 19 | Ga0466696_034220 | 3300042596 | Bacteria | 5297 |
| 20 | Ga0466699_303247 | 3300042597 | Bacteria | 1798 |
| 21 | Ga0123354_10000032 | 3300010882 | Bacteria | 104032 |
| 22 | Ga0123354_10004623 | 3300010882 | Bacteria | 19583 |
| 23 | Ga0466706_002766 | 3300042599 | Bacteria | 7616 |
| 24 | Ga0466706_082765 | 3300042599 | Bacteria | 5870 |
| 25 | Ga0466707_119903 | 3300042601 | Bacteria | 40122 |
| 26 | Ga0466707_243001 | 3300042601 | Bacteria | 4495 |
| 27 | Ga0466714_138540 | 3300042603 | Bacteria | 27343 |
| 28 | Ga0466716_084134 | 3300042605 | Bacteria | 5609 |
| 29 | Ga0466719_168647 | 3300042606 | Bacteria | 6612 |
| 30 | Ga0466722_069155 | 3300042609 | Bacteria | 2874 |
| 31 | IMNBL1DRAFT_c0000832 | 3300000062 | Bacteria | 24256 |
| 32 | IMNBL1DRAFT_c0019706 | 3300000062 | Bacteria | 2753 |
| 33 | JGI24702J35022_10003819 | 3300002462 | Bacteria | 9036 |
| 34 | JGI24696J40584_12951255 | 3300002834 | Bacteria | 2225 |
| 35 | Ga0466705_180457 | 3300042612 | Bacteria | 1949 |
| 36 | Ga0466732_347482 | 3300042656 | Unclassified | 2919 |
| 37 | Ga0466733_137476 | 3300042659 | Bacteria | 12132 |
| 38 | Ga0466733_137606 | 3300042659 | Bacteria | 6681 |
| 39 | Ga0466731_169112 | 3300042622 | Bacteria | 2997 |
| 40 | Ga0466734_015005 | 3300042623 | Bacteria | 1630 |
| 41 | Ga0466735_150457 | 3300042624 | Bacteria | 2668 |
| 42 | Ga0466708_289048 | 3300042652 | Bacteria | 7462 |
| 43 | Ga0466725_166862 | 3300042654 | Bacteria | 13165 |
| 44 | Ga0466711_247412 | 3300042615 | Bacteria | 9198 |
| 45 | Ga0466715_128031 | 3300042616 | Bacteria | 13792 |
| 46 | Ga0466715_220685 | 3300042616 | Bacteria | 4320 |
| 47 | Ga0466723_039785 | 3300042618 | Bacteria | 8720 |
| 48 | Ga0466726_075087 | 3300042619 | Bacteria | 3164 |
| 49 | Ga0466726_177393 | 3300042619 | Bacteria | 2558 |
| 50 | Ga0466728_484189 | 3300042620 | Bacteria | 7803 |
| 51 | Ga0466657_029192 | 3300042582 | Bacteria | 2248 |
| 52 | Ga0466690_276223 | 3300042590 | Bacteria | 213056 |
| 53 | Ga0466694_283102 | 3300042594 | Bacteria | 2144 |
| 54 | Ga0466695_169556 | 3300042595 | Bacteria | 3017 |
| 55 | Ga0123353_10095693 | 3300010167 | Bacteria | 4785 |
| 56 | Ga0123353_10132934 | 3300010167 | Unclassified | 3992 |
| 57 | Ga0123353_10413278 | 3300010167 | Bacteria | 2002 |
| 58 | Ga0466701_040421 | 3300042598 | Bacteria | 10469 |
| 59 | Ga0466706_019475 | 3300042599 | Bacteria | 26946 |
| 60 | Ga0466706_051309 | 3300042599 | Bacteria | 3486 |
| 61 | Ga0466706_215388 | 3300042599 | Bacteria | 5261 |
| 62 | Ga0466714_008547 | 3300042603 | Unclassified | 1864 |
| 63 | Ga0466714_048132 | 3300042603 | Bacteria | 1829 |
| 64 | Ga0466714_068648 | 3300042603 | Bacteria | 1808 |
| 65 | Ga0466716_382649 | 3300042605 | Unclassified | 1916 |
| 66 | Ga0466722_111573 | 3300042609 | Bacteria | 76934 |
| 67 | Ga0466697_042933 | 3300042611 | Bacteria | 2209 |
| 68 | JGI24702J35022_10000677 | 3300002462 | Bacteria | 20748 |
| 69 | JGI24702J35022_10008612 | 3300002462 | Bacteria | 5770 |
| 70 | JGI24705J35276_12238673 | 3300002504 | Bacteria | 35524 |
| 71 | Ga0466733_112889 | 3300042659 | Bacteria | 111775 |
| 72 | Ga0466703_138304 | 3300042636 | Unclassified | 5265 |
| 73 | Ga0466703_153503 | 3300042636 | Bacteria | 3644 |
| 74 | Ga0466704_026438 | 3300042643 | Unclassified | 6695 |
| 75 | Ga0466727_074210 | 3300042655 | Bacteria | 4168 |
| 76 | Ga0466727_263782 | 3300042655 | Bacteria | 1777 |
| 77 | Ga0466705_513213 | 3300042612 | Bacteria | 14206 |
| 78 | Ga0466711_094742 | 3300042615 | Bacteria | 2483 |
| 79 | Ga0466711_103159 | 3300042615 | Bacteria | 20028 |
| 80 | Ga0466723_022145 | 3300042618 | Bacteria | 12996 |
| 81 | Ga0466723_122406 | 3300042618 | Bacteria | 5724 |
| 82 | Ga0466728_139542 | 3300042620 | Bacteria | 2467 |
| 83 | Ga0466656_130163 | 3300042550 | Bacteria | 1918 |
| 84 | Ga0466690_170699 | 3300042590 | Bacteria | 25857 |
| 85 | Ga0466690_363270 | 3300042590 | Bacteria | 1793 |
| 86 | Ga0466696_100524 | 3300042596 | Bacteria | 16450 |
| 87 | Ga0123356_10002511 | 3300010049 | Bacteria | 19598 |
| 88 | Ga0123354_10000362 | 3300010882 | Bacteria | 42985 |
| 89 | Ga0123354_10000382 | 3300010882 | Bacteria | 42285 |
| 90 | Ga0123354_10009301 | 3300010882 | Bacteria | 15026 |
| 91 | Ga0123354_10251622 | 3300010882 | Bacteria | 1788 |
| 92 | Ga0466713_021369 | 3300042602 | Bacteria | 9437 |
| 93 | Ga0466713_068845 | 3300042602 | Bacteria | 14438 |
| 94 | Ga0466714_100570 | 3300042603 | Bacteria | 3234 |
| 95 | Ga0466714_119479 | 3300042603 | Bacteria | 3774 |
| 96 | Ga0466719_447421 | 3300042606 | Bacteria | 11699 |
| 97 | Ga0123357_10002091 | 3300009784 | Unclassified | 21960 |
| 98 | Ga0466697_110164 | 3300042611 | Bacteria | 1531 |
| 99 | Ga0466733_060503 | 3300042659 | Bacteria | 102825 |
| 100 | Ga0466733_191671 | 3300042659 | Bacteria | 9530 |
| 101 | Ga0466731_385472 | 3300042622 | Bacteria | 3061 |
| 102 | Ga0466703_399907 | 3300042636 | Bacteria | 7700 |
| 103 | Ga0466704_368649 | 3300042643 | Bacteria | 31781 |
| 104 | Ga0466708_205257 | 3300042652 | Bacteria | 30810 |
| 105 | Ga0466712_181827 | 3300042614 | Bacteria | 5479 |
| 106 | Ga0466711_032605 | 3300042615 | Bacteria | 3127 |
| 107 | Ga0466711_149101 | 3300042615 | Bacteria | 8982 |
| 108 | Ga0466715_124625 | 3300042616 | Bacteria | 5665 |
| 109 | Ga0466715_181754 | 3300042616 | Bacteria | 79863 |
| 110 | Ga0466723_068280 | 3300042618 | Bacteria | 19935 |
| 111 | Ga0466726_029778 | 3300042619 | Bacteria | 38816 |
| 112 | Ga0466726_386119 | 3300042619 | Bacteria | 5306 |
| 113 | Ga0466726_405134 | 3300042619 | Bacteria | 7863 |
| 114 | Ga0466657_012444 | 3300042582 | Bacteria | 321104 |
| 115 | Ga0466690_119907 | 3300042590 | Unclassified | 7172 |
| 116 | Ga0466692_074794 | 3300042591 | Bacteria | 46734 |
| 117 | Ga0466692_161873 | 3300042591 | Bacteria | 51547 |
| 118 | Ga0123353_10029639 | 3300010167 | Bacteria | 8439 |
| 119 | Ga0466700_332393 | 3300042600 | Bacteria | 18740 |
| 120 | Ga0466713_110263 | 3300042602 | Bacteria | 17685 |
| 121 | Ga0466716_263586 | 3300042605 | Bacteria | 2153 |
| 122 | Ga0466716_366878 | 3300042605 | Unclassified | 5875 |
| 123 | Ga0466719_058774 | 3300042606 | Bacteria | 7791 |
| 124 | Ga0466719_072632 | 3300042606 | Unclassified | 3361 |
| 125 | Ga0072941_1010329 | 3300005201 | Bacteria | 6853 |
| 126 | Ga0123357_10000694 | 3300009784 | Bacteria | 33749 |
| 127 | Ga0466733_007972 | 3300042659 | Bacteria | 14637 |
| 128 | Ga0466734_116193 | 3300042623 | Bacteria | 1636 |
| 129 | Ga0466735_175746 | 3300042624 | Bacteria | 6815 |
| 130 | Ga0466735_226991 | 3300042624 | Bacteria | 2971 |
| 131 | Ga0466703_106609 | 3300042636 | Bacteria | 26708 |
| 132 | Ga0466704_062336 | 3300042643 | Bacteria | 4250 |
| 133 | Ga0466704_294905 | 3300042643 | Bacteria | 12194 |
| 134 | Ga0466727_330365 | 3300042655 | Unclassified | 4072 |
| 135 | Ga0466705_470782 | 3300042612 | Bacteria | 13035 |
| 136 | Ga0466711_126444 | 3300042615 | Bacteria | 2591 |
| 137 | Ga0466711_300773 | 3300042615 | Bacteria | 13780 |
| 138 | Ga0466715_236197 | 3300042616 | Bacteria | 18021 |
| 139 | Ga0466715_281548 | 3300042616 | Bacteria | 7559 |
| 140 | Ga0466715_304041 | 3300042616 | Unclassified | 8652 |
| 141 | Ga0466723_093635 | 3300042618 | Bacteria | 6615 |
| 142 | Ga0466723_155582 | 3300042618 | Bacteria | 11071 |
| 143 | Ga0466657_060298 | 3300042582 | Bacteria | 2869 |
| 144 | Ga0466690_110971 | 3300042590 | Unclassified | 2839 |
| 145 | Ga0466690_162706 | 3300042590 | Bacteria | 7869 |
| 146 | Ga0466692_096389 | 3300042591 | Bacteria | 111541 |
| 147 | Ga0466696_059365 | 3300042596 | Bacteria | 4262 |
| 148 | Ga0466696_143740 | 3300042596 | Bacteria | 19531 |
| 149 | Ga0123357_10016803 | 3300009784 | Bacteria | 9654 |
| 150 | Ga0123353_10000014 | 3300010167 | Bacteria | 204767 |
| 151 | Ga0123353_10000851 | 3300010167 | Bacteria | 37039 |
| 152 | Ga0466706_034082 | 3300042599 | Unclassified | 13153 |
| 153 | Ga0466706_064847 | 3300042599 | Bacteria | 1877 |
| 154 | Ga0466706_130781 | 3300042599 | Bacteria | 43652 |
| 155 | Ga0466713_060620 | 3300042602 | Bacteria | 398690 |
| 156 | Ga0466714_073026 | 3300042603 | Bacteria | 5189 |
| 157 | Ga0466714_116335 | 3300042603 | Bacteria | 10855 |
| 158 | Ga0466717_023259 | 3300042604 | Bacteria | 15744 |
| 159 | Ga0466716_083369 | 3300042605 | Bacteria | 2184 |
| 160 | Ga0466716_479089 | 3300042605 | Bacteria | 6689 |
| 161 | Ga0466722_051219 | 3300042609 | Bacteria | 2848 |
| 162 | Ga0466722_105169 | 3300042609 | Bacteria | 1960 |
| 163 | JGI24702J35022_10072471 | 3300002462 | Bacteria | 1857 |
| 164 | Ga0123357_10001169 | 3300009784 | Bacteria | 27404 |
| 165 | Ga0466733_071802 | 3300042659 | Unclassified | 3299 |
| 166 | Ga0466733_134890 | 3300042659 | Bacteria | 9329 |
| 167 | Ga0466735_180005 | 3300042624 | Bacteria | 14797 |
| 168 | Ga0466735_232235 | 3300042624 | Bacteria | 5561 |
| 169 | Ga0466704_194440 | 3300042643 | Bacteria | 4145 |
| 170 | Ga0466704_413590 | 3300042643 | Bacteria | 6839 |
| 171 | Ga0466709_390444 | 3300042648 | Bacteria | 7475 |
| 172 | Ga0466727_028982 | 3300042655 | Bacteria | 5256 |
| 173 | Ga0466727_078492 | 3300042655 | Bacteria | 66886 |
| 174 | Ga0466727_088441 | 3300042655 | Bacteria | 2281 |
| 175 | Ga0466715_316557 | 3300042616 | Bacteria | 16374 |
| 176 | Ga0466723_048085 | 3300042618 | Bacteria | 14153 |
| 177 | Ga0466728_096371 | 3300042620 | Bacteria | 11852 |
| 178 | Ga0466728_286555 | 3300042620 | Bacteria | 9184 |
| 179 | Ga0466690_035128 | 3300042590 | Bacteria | 21568 |
| 180 | Ga0466690_420485 | 3300042590 | Bacteria | 6046 |
| 181 | Ga0466691_097240 | 3300042593 | Bacteria | 7369 |
| 182 | Ga0123356_10045197 | 3300010049 | Bacteria | 4098 |
| 183 | Ga0123354_10055362 | 3300010882 | Bacteria | 5938 |
| 184 | Ga0466700_004310 | 3300042600 | Bacteria | 3129 |
| 185 | Ga0466700_404277 | 3300042600 | Bacteria | 3600 |
| 186 | Ga0466707_031569 | 3300042601 | Bacteria | 4357 |
| 187 | Ga0466707_351680 | 3300042601 | Bacteria | 2256 |
| 188 | Ga0466713_008757 | 3300042602 | Bacteria | 124939 |
| 189 | Ga0466714_149990 | 3300042603 | Bacteria | 3481 |
| 190 | Ga0466716_097553 | 3300042605 | Bacteria | 5927 |
| 191 | Ga0466719_111332 | 3300042606 | Bacteria | 20001 |
| 192 | Ga0466722_034174 | 3300042609 | Bacteria | 3604 |
| 193 | Ga0466722_057178 | 3300042609 | Bacteria | 17242 |
| 194 | Ga0466722_233044 | 3300042609 | Bacteria | 2595 |
| 195 | Ga0466697_027951 | 3300042611 | Bacteria | 74281 |
| 196 | Ga0068305_10067874 | 3300005083 | Unclassified | 3234 |
| 197 | Ga0072941_1089900 | 3300005201 | Bacteria | 5689 |
| 198 | Ga0466733_202415 | 3300042659 | Bacteria | 5449 |
| 199 | Ga0466734_035081 | 3300042623 | Bacteria | 1770 |
| 200 | Ga0466703_080326 | 3300042636 | Bacteria | 5767 |
| 201 | Ga0466704_026770 | 3300042643 | Bacteria | 49720 |
| 202 | Ga0466708_135829 | 3300042652 | Bacteria | 25210 |
| 203 | Ga0466708_388371 | 3300042652 | Unclassified | 4355 |
| 204 | Ga0466711_345560 | 3300042615 | Bacteria | 13113 |
| 205 | Ga0466715_140951 | 3300042616 | Bacteria | 4737 |
| 206 | Ga0466715_165242 | 3300042616 | Bacteria | 12601 |
| 207 | Ga0466715_413862 | 3300042616 | Bacteria | 54460 |
| 208 | Ga0466723_349603 | 3300042618 | Bacteria | 4944 |
| 209 | Ga0466726_246055 | 3300042619 | Bacteria | 2779 |
| 210 | Ga0466726_281727 | 3300042619 | Bacteria | 7083 |
| 211 | Ga0466726_459026 | 3300042619 | Bacteria | 2882 |
| 212 | Ga0466690_036055 | 3300042590 | Bacteria | 9031 |
| 213 | Ga0466692_169238 | 3300042591 | Bacteria | 323278 |
| 214 | Ga0466693_026701 | 3300042592 | Bacteria | 6048 |
| 215 | Ga0466691_037827 | 3300042593 | Bacteria | 15968 |
| 216 | Ga0466691_116256 | 3300042593 | Bacteria | 26253 |
| 217 | Ga0123353_10366271 | 3300010167 | Bacteria | 2163 |
| 218 | Ga0123353_10466274 | 3300010167 | Bacteria | 1854 |
| 219 | Ga0466701_027105 | 3300042598 | Bacteria | 16350 |
| 220 | Ga0466701_051028 | 3300042598 | Bacteria | 3626 |
| 221 | Ga0466700_249204 | 3300042600 | Bacteria | 41013 |
| 222 | Ga0466713_025060 | 3300042602 | Bacteria | 48276 |
| 223 | Ga0466714_006756 | 3300042603 | Bacteria | 211810 |
| 224 | Ga0466714_011295 | 3300042603 | Bacteria | 9252 |
| 225 | Ga0466714_058112 | 3300042603 | Bacteria | 3590 |
| 226 | Ga0466714_059498 | 3300042603 | Bacteria | 52958 |
| 227 | Ga0466722_131083 | 3300042609 | Bacteria | 2787 |
| 228 | 2227155792 | 2225789004 | Bacteria | 8474 |
| 229 | Ga0466733_007263 | 3300042659 | Bacteria | 5873 |
| 230 | Ga0466733_169226 | 3300042659 | Bacteria | 14624 |
| 231 | Ga0466703_154783 | 3300042636 | Unclassified | 5689 |
| 232 | Ga0466725_270457 | 3300042654 | Bacteria | 24948 |
| 233 | Ga0466727_055779 | 3300042655 | Bacteria | 19434 |
| 234 | Ga0466727_182354 | 3300042655 | Bacteria | 14458 |
| 235 | Ga0466711_304354 | 3300042615 | Bacteria | 6049 |
| 236 | Ga0466711_353023 | 3300042615 | Bacteria | 6943 |
| 237 | Ga0466690_353896 | 3300042590 | Bacteria | 2902 |
| 238 | Ga0466696_358288 | 3300042596 | Bacteria | 3161 |
| 239 | Ga0123357_10043268 | 3300009784 | Bacteria | 6120 |
| 240 | Ga0123356_10007216 | 3300010049 | Bacteria | 11114 |
| 241 | Ga0123356_10122077 | 3300010049 | Bacteria | 2536 |
| 242 | Ga0123356_10176324 | 3300010049 | Bacteria | 2154 |
| 243 | Ga0123354_10183632 | 3300010882 | Bacteria | 2375 |
| 244 | Ga0123354_10253250 | 3300010882 | Bacteria | 1778 |
| 245 | Ga0466701_022884 | 3300042598 | Bacteria | 48643 |
| 246 | Ga0466701_061347 | 3300042598 | Bacteria | 18352 |
| 247 | Ga0466706_168300 | 3300042599 | Bacteria | 28378 |
| 248 | Ga0466707_280199 | 3300042601 | Bacteria | 8669 |
| 249 | Ga0466713_078868 | 3300042602 | Bacteria | 140260 |
| 250 | Ga0466722_023105 | 3300042609 | Bacteria | 6828 |
| 251 | Ga0466722_071889 | 3300042609 | Bacteria | 4382 |
| 252 | IMNBL1DRAFT_c0000445 | 3300000062 | Bacteria | 34629 |
| 253 | Ga0072941_1560884 | 3300005201 | Bacteria | 2087 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01212 | Beta_elim_lyase | Beta-eliminating lyase | 114 | 488 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.