Protein Family IF08291

Metagenome Isolate
279 Members
78 Samples
253 Scaffolds
486.45 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_281727|Ga0466726_281727_5036_6664
Length
542 aa
Sequence
MCVFETVFASRREITNLICQICLQFVSNLFCEAQKPPLNRKKSLTLQPFSTKFSTLKKVMETIKFYSGEQFPLELHKVRVVQKLNLVPIERRLEALYEGGFNTFRLSTKDVFLDMLTDSGTNAMSDMQLSAMMHADDAYAGSQSFYRLLKAVQDVLRKQYFLPTHQGRAAENVLTKAYITKPGALVPTNYHFTTFLADVTMYGGRVVELLYDEAFNISSSHPFKGNMNVEKLDEVIRETGAENIPFIRMEASTNLIGGQPFSVENLRQVRRVADKYGIRLVLDASLLGENAYLVLQREKEFASSNMGEVIATMTGLADIVYFSARKLSSSRGGGICTSSEKISRELEALIPLFEGFLTYGGISVREIEAMAVGLYETLDESMICQSPSFIAYLVNGLVAKGVPMVTPAGVLGAHVDAMRMCAHIPQTQYPAGSLAAAFFLVSGVRGMERGSVSNQRDAEGNETYADMELLRLAVPRRVFTLSQIKYVEDRMKWLYDNRQLIGGLHFVYEPPVLRFFMGGMEPVSDWPKKLMAKFKADFGESL

πŸ“Š Sample Types

Isolate 9.3%
Metagenome 90.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 32.5%
Unclassified 19.5%
Kalotermitidae 18.2%
Blattidae 14.3%
Rhinotermitidae 7.8%
Termopsidae 3.9%
Passalidae 2.6%
Hodotermitidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 261
Eukaryota 0
Viruses 0
Unclassified 18

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
2 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
3 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
4 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
5 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
6 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
7 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
8 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
9 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
12 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
13 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
14 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
15 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
16 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
19 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
27 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
28 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
36 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
37 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
38 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
39 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
40 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
41 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
42 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
43 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
44 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
47 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
48 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
49 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
50 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
51 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
52 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
53 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
54 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
55 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
56 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
57 2920168565 Paludibacter sp. 221 Isolate Blattidae
58 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
59 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
60 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
61 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
62 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
63 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
64 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
65 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
66 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
67 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
68 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
69 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
70 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
71 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
72 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
73 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
74 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
75 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
76 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
77 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
78 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_234097 3300042612 Bacteria 28349
2 Ga0466732_318401 3300042656 Bacteria 83583
3 Ga0466734_045724 3300042623 Bacteria 3398
4 Ga0466730_063669 3300042625 Bacteria 4347
5 Ga0466703_062668 3300042636 Bacteria 5475
6 Ga0466703_073161 3300042636 Bacteria 6359
7 Ga0466704_298469 3300042643 Bacteria 13889
8 Ga0466708_129757 3300042652 Bacteria 16862
9 Ga0466708_140192 3300042652 Bacteria 12348
10 Ga0466727_223488 3300042655 Bacteria 8202
11 Ga0466711_096104 3300042615 Bacteria 2480
12 Ga0466715_084192 3300042616 Bacteria 39268
13 Ga0466715_152522 3300042616 Bacteria 3581
14 Ga0466715_500599 3300042616 Bacteria 7095
15 Ga0466729_061813 3300042621 Bacteria 13331
16 Ga0466657_011133 3300042582 Bacteria 16184
17 Ga0466692_133437 3300042591 Bacteria 2544
18 Ga0466691_087689 3300042593 Bacteria 15679
19 Ga0466696_034220 3300042596 Bacteria 5297
20 Ga0466699_303247 3300042597 Bacteria 1798
21 Ga0123354_10000032 3300010882 Bacteria 104032
22 Ga0123354_10004623 3300010882 Bacteria 19583
23 Ga0466706_002766 3300042599 Bacteria 7616
24 Ga0466706_082765 3300042599 Bacteria 5870
25 Ga0466707_119903 3300042601 Bacteria 40122
26 Ga0466707_243001 3300042601 Bacteria 4495
27 Ga0466714_138540 3300042603 Bacteria 27343
28 Ga0466716_084134 3300042605 Bacteria 5609
29 Ga0466719_168647 3300042606 Bacteria 6612
30 Ga0466722_069155 3300042609 Bacteria 2874
31 IMNBL1DRAFT_c0000832 3300000062 Bacteria 24256
32 IMNBL1DRAFT_c0019706 3300000062 Bacteria 2753
33 JGI24702J35022_10003819 3300002462 Bacteria 9036
34 JGI24696J40584_12951255 3300002834 Bacteria 2225
35 Ga0466705_180457 3300042612 Bacteria 1949
36 Ga0466732_347482 3300042656 Unclassified 2919
37 Ga0466733_137476 3300042659 Bacteria 12132
38 Ga0466733_137606 3300042659 Bacteria 6681
39 Ga0466731_169112 3300042622 Bacteria 2997
40 Ga0466734_015005 3300042623 Bacteria 1630
41 Ga0466735_150457 3300042624 Bacteria 2668
42 Ga0466708_289048 3300042652 Bacteria 7462
43 Ga0466725_166862 3300042654 Bacteria 13165
44 Ga0466711_247412 3300042615 Bacteria 9198
45 Ga0466715_128031 3300042616 Bacteria 13792
46 Ga0466715_220685 3300042616 Bacteria 4320
47 Ga0466723_039785 3300042618 Bacteria 8720
48 Ga0466726_075087 3300042619 Bacteria 3164
49 Ga0466726_177393 3300042619 Bacteria 2558
50 Ga0466728_484189 3300042620 Bacteria 7803
51 Ga0466657_029192 3300042582 Bacteria 2248
52 Ga0466690_276223 3300042590 Bacteria 213056
53 Ga0466694_283102 3300042594 Bacteria 2144
54 Ga0466695_169556 3300042595 Bacteria 3017
55 Ga0123353_10095693 3300010167 Bacteria 4785
56 Ga0123353_10132934 3300010167 Unclassified 3992
57 Ga0123353_10413278 3300010167 Bacteria 2002
58 Ga0466701_040421 3300042598 Bacteria 10469
59 Ga0466706_019475 3300042599 Bacteria 26946
60 Ga0466706_051309 3300042599 Bacteria 3486
61 Ga0466706_215388 3300042599 Bacteria 5261
62 Ga0466714_008547 3300042603 Unclassified 1864
63 Ga0466714_048132 3300042603 Bacteria 1829
64 Ga0466714_068648 3300042603 Bacteria 1808
65 Ga0466716_382649 3300042605 Unclassified 1916
66 Ga0466722_111573 3300042609 Bacteria 76934
67 Ga0466697_042933 3300042611 Bacteria 2209
68 JGI24702J35022_10000677 3300002462 Bacteria 20748
69 JGI24702J35022_10008612 3300002462 Bacteria 5770
70 JGI24705J35276_12238673 3300002504 Bacteria 35524
71 Ga0466733_112889 3300042659 Bacteria 111775
72 Ga0466703_138304 3300042636 Unclassified 5265
73 Ga0466703_153503 3300042636 Bacteria 3644
74 Ga0466704_026438 3300042643 Unclassified 6695
75 Ga0466727_074210 3300042655 Bacteria 4168
76 Ga0466727_263782 3300042655 Bacteria 1777
77 Ga0466705_513213 3300042612 Bacteria 14206
78 Ga0466711_094742 3300042615 Bacteria 2483
79 Ga0466711_103159 3300042615 Bacteria 20028
80 Ga0466723_022145 3300042618 Bacteria 12996
81 Ga0466723_122406 3300042618 Bacteria 5724
82 Ga0466728_139542 3300042620 Bacteria 2467
83 Ga0466656_130163 3300042550 Bacteria 1918
84 Ga0466690_170699 3300042590 Bacteria 25857
85 Ga0466690_363270 3300042590 Bacteria 1793
86 Ga0466696_100524 3300042596 Bacteria 16450
87 Ga0123356_10002511 3300010049 Bacteria 19598
88 Ga0123354_10000362 3300010882 Bacteria 42985
89 Ga0123354_10000382 3300010882 Bacteria 42285
90 Ga0123354_10009301 3300010882 Bacteria 15026
91 Ga0123354_10251622 3300010882 Bacteria 1788
92 Ga0466713_021369 3300042602 Bacteria 9437
93 Ga0466713_068845 3300042602 Bacteria 14438
94 Ga0466714_100570 3300042603 Bacteria 3234
95 Ga0466714_119479 3300042603 Bacteria 3774
96 Ga0466719_447421 3300042606 Bacteria 11699
97 Ga0123357_10002091 3300009784 Unclassified 21960
98 Ga0466697_110164 3300042611 Bacteria 1531
99 Ga0466733_060503 3300042659 Bacteria 102825
100 Ga0466733_191671 3300042659 Bacteria 9530
101 Ga0466731_385472 3300042622 Bacteria 3061
102 Ga0466703_399907 3300042636 Bacteria 7700
103 Ga0466704_368649 3300042643 Bacteria 31781
104 Ga0466708_205257 3300042652 Bacteria 30810
105 Ga0466712_181827 3300042614 Bacteria 5479
106 Ga0466711_032605 3300042615 Bacteria 3127
107 Ga0466711_149101 3300042615 Bacteria 8982
108 Ga0466715_124625 3300042616 Bacteria 5665
109 Ga0466715_181754 3300042616 Bacteria 79863
110 Ga0466723_068280 3300042618 Bacteria 19935
111 Ga0466726_029778 3300042619 Bacteria 38816
112 Ga0466726_386119 3300042619 Bacteria 5306
113 Ga0466726_405134 3300042619 Bacteria 7863
114 Ga0466657_012444 3300042582 Bacteria 321104
115 Ga0466690_119907 3300042590 Unclassified 7172
116 Ga0466692_074794 3300042591 Bacteria 46734
117 Ga0466692_161873 3300042591 Bacteria 51547
118 Ga0123353_10029639 3300010167 Bacteria 8439
119 Ga0466700_332393 3300042600 Bacteria 18740
120 Ga0466713_110263 3300042602 Bacteria 17685
121 Ga0466716_263586 3300042605 Bacteria 2153
122 Ga0466716_366878 3300042605 Unclassified 5875
123 Ga0466719_058774 3300042606 Bacteria 7791
124 Ga0466719_072632 3300042606 Unclassified 3361
125 Ga0072941_1010329 3300005201 Bacteria 6853
126 Ga0123357_10000694 3300009784 Bacteria 33749
127 Ga0466733_007972 3300042659 Bacteria 14637
128 Ga0466734_116193 3300042623 Bacteria 1636
129 Ga0466735_175746 3300042624 Bacteria 6815
130 Ga0466735_226991 3300042624 Bacteria 2971
131 Ga0466703_106609 3300042636 Bacteria 26708
132 Ga0466704_062336 3300042643 Bacteria 4250
133 Ga0466704_294905 3300042643 Bacteria 12194
134 Ga0466727_330365 3300042655 Unclassified 4072
135 Ga0466705_470782 3300042612 Bacteria 13035
136 Ga0466711_126444 3300042615 Bacteria 2591
137 Ga0466711_300773 3300042615 Bacteria 13780
138 Ga0466715_236197 3300042616 Bacteria 18021
139 Ga0466715_281548 3300042616 Bacteria 7559
140 Ga0466715_304041 3300042616 Unclassified 8652
141 Ga0466723_093635 3300042618 Bacteria 6615
142 Ga0466723_155582 3300042618 Bacteria 11071
143 Ga0466657_060298 3300042582 Bacteria 2869
144 Ga0466690_110971 3300042590 Unclassified 2839
145 Ga0466690_162706 3300042590 Bacteria 7869
146 Ga0466692_096389 3300042591 Bacteria 111541
147 Ga0466696_059365 3300042596 Bacteria 4262
148 Ga0466696_143740 3300042596 Bacteria 19531
149 Ga0123357_10016803 3300009784 Bacteria 9654
150 Ga0123353_10000014 3300010167 Bacteria 204767
151 Ga0123353_10000851 3300010167 Bacteria 37039
152 Ga0466706_034082 3300042599 Unclassified 13153
153 Ga0466706_064847 3300042599 Bacteria 1877
154 Ga0466706_130781 3300042599 Bacteria 43652
155 Ga0466713_060620 3300042602 Bacteria 398690
156 Ga0466714_073026 3300042603 Bacteria 5189
157 Ga0466714_116335 3300042603 Bacteria 10855
158 Ga0466717_023259 3300042604 Bacteria 15744
159 Ga0466716_083369 3300042605 Bacteria 2184
160 Ga0466716_479089 3300042605 Bacteria 6689
161 Ga0466722_051219 3300042609 Bacteria 2848
162 Ga0466722_105169 3300042609 Bacteria 1960
163 JGI24702J35022_10072471 3300002462 Bacteria 1857
164 Ga0123357_10001169 3300009784 Bacteria 27404
165 Ga0466733_071802 3300042659 Unclassified 3299
166 Ga0466733_134890 3300042659 Bacteria 9329
167 Ga0466735_180005 3300042624 Bacteria 14797
168 Ga0466735_232235 3300042624 Bacteria 5561
169 Ga0466704_194440 3300042643 Bacteria 4145
170 Ga0466704_413590 3300042643 Bacteria 6839
171 Ga0466709_390444 3300042648 Bacteria 7475
172 Ga0466727_028982 3300042655 Bacteria 5256
173 Ga0466727_078492 3300042655 Bacteria 66886
174 Ga0466727_088441 3300042655 Bacteria 2281
175 Ga0466715_316557 3300042616 Bacteria 16374
176 Ga0466723_048085 3300042618 Bacteria 14153
177 Ga0466728_096371 3300042620 Bacteria 11852
178 Ga0466728_286555 3300042620 Bacteria 9184
179 Ga0466690_035128 3300042590 Bacteria 21568
180 Ga0466690_420485 3300042590 Bacteria 6046
181 Ga0466691_097240 3300042593 Bacteria 7369
182 Ga0123356_10045197 3300010049 Bacteria 4098
183 Ga0123354_10055362 3300010882 Bacteria 5938
184 Ga0466700_004310 3300042600 Bacteria 3129
185 Ga0466700_404277 3300042600 Bacteria 3600
186 Ga0466707_031569 3300042601 Bacteria 4357
187 Ga0466707_351680 3300042601 Bacteria 2256
188 Ga0466713_008757 3300042602 Bacteria 124939
189 Ga0466714_149990 3300042603 Bacteria 3481
190 Ga0466716_097553 3300042605 Bacteria 5927
191 Ga0466719_111332 3300042606 Bacteria 20001
192 Ga0466722_034174 3300042609 Bacteria 3604
193 Ga0466722_057178 3300042609 Bacteria 17242
194 Ga0466722_233044 3300042609 Bacteria 2595
195 Ga0466697_027951 3300042611 Bacteria 74281
196 Ga0068305_10067874 3300005083 Unclassified 3234
197 Ga0072941_1089900 3300005201 Bacteria 5689
198 Ga0466733_202415 3300042659 Bacteria 5449
199 Ga0466734_035081 3300042623 Bacteria 1770
200 Ga0466703_080326 3300042636 Bacteria 5767
201 Ga0466704_026770 3300042643 Bacteria 49720
202 Ga0466708_135829 3300042652 Bacteria 25210
203 Ga0466708_388371 3300042652 Unclassified 4355
204 Ga0466711_345560 3300042615 Bacteria 13113
205 Ga0466715_140951 3300042616 Bacteria 4737
206 Ga0466715_165242 3300042616 Bacteria 12601
207 Ga0466715_413862 3300042616 Bacteria 54460
208 Ga0466723_349603 3300042618 Bacteria 4944
209 Ga0466726_246055 3300042619 Bacteria 2779
210 Ga0466726_281727 3300042619 Bacteria 7083
211 Ga0466726_459026 3300042619 Bacteria 2882
212 Ga0466690_036055 3300042590 Bacteria 9031
213 Ga0466692_169238 3300042591 Bacteria 323278
214 Ga0466693_026701 3300042592 Bacteria 6048
215 Ga0466691_037827 3300042593 Bacteria 15968
216 Ga0466691_116256 3300042593 Bacteria 26253
217 Ga0123353_10366271 3300010167 Bacteria 2163
218 Ga0123353_10466274 3300010167 Bacteria 1854
219 Ga0466701_027105 3300042598 Bacteria 16350
220 Ga0466701_051028 3300042598 Bacteria 3626
221 Ga0466700_249204 3300042600 Bacteria 41013
222 Ga0466713_025060 3300042602 Bacteria 48276
223 Ga0466714_006756 3300042603 Bacteria 211810
224 Ga0466714_011295 3300042603 Bacteria 9252
225 Ga0466714_058112 3300042603 Bacteria 3590
226 Ga0466714_059498 3300042603 Bacteria 52958
227 Ga0466722_131083 3300042609 Bacteria 2787
228 2227155792 2225789004 Bacteria 8474
229 Ga0466733_007263 3300042659 Bacteria 5873
230 Ga0466733_169226 3300042659 Bacteria 14624
231 Ga0466703_154783 3300042636 Unclassified 5689
232 Ga0466725_270457 3300042654 Bacteria 24948
233 Ga0466727_055779 3300042655 Bacteria 19434
234 Ga0466727_182354 3300042655 Bacteria 14458
235 Ga0466711_304354 3300042615 Bacteria 6049
236 Ga0466711_353023 3300042615 Bacteria 6943
237 Ga0466690_353896 3300042590 Bacteria 2902
238 Ga0466696_358288 3300042596 Bacteria 3161
239 Ga0123357_10043268 3300009784 Bacteria 6120
240 Ga0123356_10007216 3300010049 Bacteria 11114
241 Ga0123356_10122077 3300010049 Bacteria 2536
242 Ga0123356_10176324 3300010049 Bacteria 2154
243 Ga0123354_10183632 3300010882 Bacteria 2375
244 Ga0123354_10253250 3300010882 Bacteria 1778
245 Ga0466701_022884 3300042598 Bacteria 48643
246 Ga0466701_061347 3300042598 Bacteria 18352
247 Ga0466706_168300 3300042599 Bacteria 28378
248 Ga0466707_280199 3300042601 Bacteria 8669
249 Ga0466713_078868 3300042602 Bacteria 140260
250 Ga0466722_023105 3300042609 Bacteria 6828
251 Ga0466722_071889 3300042609 Bacteria 4382
252 IMNBL1DRAFT_c0000445 3300000062 Bacteria 34629
253 Ga0072941_1560884 3300005201 Bacteria 2087

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01212 Beta_elim_lyase Beta-eliminating lyase 114 488 0.96

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.