Protein Family IF08286
Metagenome
Metatranscriptome
Isolate
356
Members
202
Samples
242
Scaffolds
409.78
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_266592|Ga0466726_266592_922_2352
- Length
- 476 aa
- Sequence
- MFHKHIRKKTARENRQPPPLFKGKVFCYAANPPPPLALSACSGGLVLFPAPXPLSLITQTEMKIVLAYSGGLDTSVIVKWLRETYDAEIITFAADLGQEEELKGLDKKARATGASKHYTLDLVEDFARDYIFPMVRANAIYEGQYYLGTSIARPLIAKAQVEIARKEKADTVAHGATGKGNDQCRFELSYMALAPRLNIVAPWKIEAFREQFPGRAEMIAYCQKHQIPVEASLKKPYSMDRNLLHISYEAGILEDPWFDPTVAKNKDMFKLSVSPEDAPDKPEFVEIEFLKGDAVAVNGKQLTPGALLRALNKLGGKHGIGRVDIVENRFVGMKSRGVYETPGGTILTHAHRQVETLTLDRDLEHLRDTLVPKYAELIYNGFWFAPEREALQAFIDKSQEFVTGTVRLKLYKGNIITCGRKSPYSLYNESVASMEGVESDYNQSDAVGFIRLNGLRLRARAHAQGAPKYAPIKALK
Sample Types
Isolate
32.0%
Metagenome
66.3%
MAG
0.0%
Metatranscriptome
1.7%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
32.1%
Termitidae
16.3%
Coreidae
14.8%
Formicidae
7.1%
Blattidae
6.6%
Kalotermitidae
6.6%
Tenebrionidae
3.1%
Rhinotermitidae
2.0%
Termopsidae
2.0%
Passalidae
1.5%
Elmidae
1.5%
Culicidae
1.5%
Apidae
1.0%
Armadillidiidae
0.5%
Hodotermitidae
0.5%
Aleyrodidae
0.5%
Alydidae
0.5%
Kiwaidae
0.5%
Scarabaeidae
0.5%
Noctuidae
0.5%
Taxonomy
Archaea
0
Bacteria
327
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 2 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 3 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 4 | 2820907832 | Unclassified Actinobacteria Emb289P4bin29 | Isolate | Unclassified |
| 5 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 6 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 7 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 8 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 9 | 2820716747 | Unclassified Fibrobacteres Nc150P3bin18 | Isolate | Unclassified |
| 10 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 15 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 23 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 24 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 25 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 34 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 35 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 36 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 37 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 38 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 39 | 2820242869 | Unclassified Firmicutes Th196P3bin82 | Isolate | Unclassified |
| 40 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 41 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 42 | 2820714932 | Unclassified Fibrobacteres Nc150P4bin10 | Isolate | Unclassified |
| 43 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 44 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 45 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 46 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 47 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 48 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 49 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 50 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 51 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 52 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 53 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 54 | 3300060706 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Day0a (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 55 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 56 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 57 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 58 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 59 | 2821322763 | Unclassified Actinobacteria Cu122P5bin19 | Isolate | Unclassified |
| 60 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 61 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 62 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 63 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 64 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 65 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 66 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 67 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 68 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 69 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 70 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 71 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 72 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 73 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 74 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 75 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 76 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 77 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 78 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 79 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 80 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 81 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 82 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 83 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 84 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 85 | 2603880164 | Opitutus sp. | Isolate | Formicidae |
| 86 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 87 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 88 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 89 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 90 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 91 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 92 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 93 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 94 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 95 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 96 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 97 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 98 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 99 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 100 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 101 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 102 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 103 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 104 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 105 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 106 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 107 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 108 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 109 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 110 | 2518285589 | Candidatus Portiera aleyrodidarum TV (unscreened) | Isolate | Aleyrodidae |
| 111 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 112 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 113 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 114 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 115 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 116 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 117 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 118 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 119 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 120 | 2820569216 | Unclassified Firmicutes Emb289P3bin33 | Isolate | Unclassified |
| 121 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 122 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 123 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 124 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 125 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 126 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 127 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 128 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 129 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 130 | 3300060759 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PS_oats_a (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 131 | 3300060766 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_LDPE_b (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 132 | 3300060772 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 133 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 134 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 135 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 136 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 137 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 138 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 139 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 140 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 141 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 142 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 143 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 144 | 2778260939 | Unclassified Fibrobacteres Co191P4bin13 | Isolate | Unclassified |
| 145 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 146 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 147 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 148 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 149 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 150 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 151 | 2820296961 | Unclassified Firmicutes Th196P3bin102 | Isolate | Unclassified |
| 152 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 153 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 154 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 155 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 156 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 157 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 158 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 159 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 160 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 161 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 162 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 163 | 3300060775 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 164 | 2820942695 | Unclassified Actinobacteria Cu122P5bin37 | Isolate | Unclassified |
| 165 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 166 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 167 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 168 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 169 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 170 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 171 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 172 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 173 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 174 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 175 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 176 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 177 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 178 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 179 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 180 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 181 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 182 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 183 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 184 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 185 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 186 | 2687453757 | Opitutus sp. Cag34 | Isolate | Unclassified |
| 187 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 188 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 189 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 190 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 191 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 192 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 193 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 194 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 195 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 196 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 197 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 198 | 3300060756 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_HDPE_oats_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 199 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 200 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 201 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 202 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10052506 | 3300010049 | Unclassified | 3792 |
| 2 | Ga0123353_10123295 | 3300010167 | Bacteria | 4165 |
| 3 | Ga0466701_034356 | 3300042598 | Bacteria | 72007 |
| 4 | Ga0466713_071200 | 3300042602 | Bacteria | 26671 |
| 5 | Ga0466716_309995 | 3300042605 | Bacteria | 6243 |
| 6 | Ga0466716_312493 | 3300042605 | Bacteria | 3164 |
| 7 | Ga0466722_192812 | 3300042609 | Bacteria | 4738 |
| 8 | Ga0466710_057631 | 3300042613 | Bacteria | 1730 |
| 9 | Ga0466710_166744 | 3300042613 | Bacteria | 2226 |
| 10 | Ga0466711_296459 | 3300042615 | Bacteria | 5489 |
| 11 | 2227558263 | 2225789004 | Bacteria | 2756 |
| 12 | JGI24696J40584_12958665 | 3300002834 | Bacteria | 4312 |
| 13 | Ga0068302_10038251 | 3300005071 | Bacteria | 5624 |
| 14 | Ga0072941_1025224 | 3300005201 | Bacteria | 16924 |
| 15 | Ga0466735_125212 | 3300042624 | Bacteria | 3966 |
| 16 | Ga0466735_142629 | 3300042624 | Bacteria | 15378 |
| 17 | Ga0466702_218059 | 3300042635 | Bacteria | 2657 |
| 18 | Ga0466708_319577 | 3300042652 | Bacteria | 8636 |
| 19 | Ga0466727_126543 | 3300042655 | Bacteria | 3763 |
| 20 | Ga0466727_191545 | 3300042655 | Bacteria | 4389 |
| 21 | Ga0264413_100816 | 3300024493 | Unclassified | 20524 |
| 22 | Ga0264413_101854 | 3300024493 | Unclassified | 2634 |
| 23 | Ga0466692_096389 | 3300042591 | Bacteria | 111541 |
| 24 | Ga0466693_424769 | 3300042592 | Bacteria | 2219 |
| 25 | Ga0466691_026078 | 3300042593 | Unclassified | 20831 |
| 26 | Ga0466694_261055 | 3300042594 | Unclassified | 2355 |
| 27 | Ga0466696_073796 | 3300042596 | Bacteria | 10978 |
| 28 | Ga0466699_234959 | 3300042597 | Bacteria | 5630 |
| 29 | Ga0590772_00643 | 3300060756 | Unclassified | 4233 |
| 30 | Ga0590776_00692 | 3300060759 | Unclassified | 4048 |
| 31 | Ga0123357_10004916 | 3300009784 | Bacteria | 15854 |
| 32 | Ga0123355_10094159 | 3300009826 | Bacteria | 4740 |
| 33 | Ga0123354_10004840 | 3300010882 | Unclassified | 19276 |
| 34 | Ga0123354_10175375 | 3300010882 | Bacteria | 2474 |
| 35 | Ga0466722_046563 | 3300042609 | Bacteria | 7180 |
| 36 | Ga0466722_178076 | 3300042609 | Bacteria | 16801 |
| 37 | Ga0466710_040430 | 3300042613 | Bacteria | 27544 |
| 38 | Ga0466715_307818 | 3300042616 | Bacteria | 58612 |
| 39 | Ga0466715_420607 | 3300042616 | Bacteria | 23596 |
| 40 | Ga0466726_065034 | 3300042619 | Bacteria | 18494 |
| 41 | Ga0466728_190681 | 3300042620 | Bacteria | 53550 |
| 42 | IMNBL1DRAFT_c0001190 | 3300000062 | Bacteria | 19769 |
| 43 | CVPL005W_1001479 | 3300002934 | Unclassified | 15404 |
| 44 | Ga0068305_10052701 | 3300005083 | Bacteria | 4515 |
| 45 | Ga0102733_100024 | 3300006995 | Bacteria | 31052 |
| 46 | Ga0103263_100013 | 3300007042 | Bacteria | 45098 |
| 47 | Ga0102735_1000072 | 3300007080 | Bacteria | 50908 |
| 48 | Ga0103261_1000005 | 3300007083 | Bacteria | 157552 |
| 49 | Ga0466734_128029 | 3300042623 | Bacteria | 9199 |
| 50 | Ga0466735_220976 | 3300042624 | Unclassified | 5871 |
| 51 | Ga0466725_023112 | 3300042654 | Bacteria | 48186 |
| 52 | Ga0466692_053051 | 3300042591 | Bacteria | 75912 |
| 53 | Ga0466695_370903 | 3300042595 | Bacteria | 6546 |
| 54 | Ga0466733_080847 | 3300042659 | Bacteria | 30122 |
| 55 | Ga0590815_01201 | 3300060706 | Unclassified | 4099 |
| 56 | Ga0590799_05227 | 3300060775 | Unclassified | 1409 |
| 57 | Ga0123353_10004716 | 3300010167 | Bacteria | 17651 |
| 58 | Ga0123353_10105506 | 3300010167 | Bacteria | 4541 |
| 59 | Ga0123353_10157817 | 3300010167 | Bacteria | 3614 |
| 60 | Ga0466706_025250 | 3300042599 | Bacteria | 6630 |
| 61 | Ga0466706_094005 | 3300042599 | Bacteria | 26377 |
| 62 | Ga0466706_204759 | 3300042599 | Bacteria | 1996 |
| 63 | Ga0466707_105188 | 3300042601 | Bacteria | 18720 |
| 64 | Ga0466720_083162 | 3300042607 | Bacteria | 29596 |
| 65 | Ga0466711_197867 | 3300042615 | Bacteria | 6114 |
| 66 | Ga0466718_057720 | 3300042617 | Bacteria | 6150 |
| 67 | Ga0466718_091226 | 3300042617 | Bacteria | 18188 |
| 68 | Ga0466726_310288 | 3300042619 | Bacteria | 1981 |
| 69 | IMNBL1DRAFT_c0004397 | 3300000062 | Bacteria | 8495 |
| 70 | IMNBL1DRAFT_c0006089 | 3300000062 | Bacteria | 6700 |
| 71 | AustNasuHG_c1026128 | 3300000089 | Bacteria | 1823 |
| 72 | JGI24698J34947_10053700 | 3300002449 | Bacteria | 2015 |
| 73 | JGI24699J35502_11098928 | 3300002509 | Unclassified | 2307 |
| 74 | Ga0068305_10041510 | 3300005083 | Bacteria | 11430 |
| 75 | Ga0072941_1013067 | 3300005201 | Bacteria | 7870 |
| 76 | Ga0072941_1024258 | 3300005201 | Bacteria | 20119 |
| 77 | Ga0072941_1033709 | 3300005201 | Unclassified | 11654 |
| 78 | Ga0102737_1000519 | 3300007142 | Unclassified | 12587 |
| 79 | Ga0466729_273882 | 3300042621 | Bacteria | 8624 |
| 80 | Ga0466704_117704 | 3300042643 | Bacteria | 3193 |
| 81 | Ga0466708_106595 | 3300042652 | Bacteria | 59435 |
| 82 | Ga0466727_042477 | 3300042655 | Bacteria | 75148 |
| 83 | Ga0466727_044140 | 3300042655 | Bacteria | 29656 |
| 84 | Ga0160467_100291 | 3300012829 | Bacteria | 58363 |
| 85 | Ga0160434_102298 | 3300012850 | Bacteria | 3332 |
| 86 | Ga0466690_090551 | 3300042590 | Bacteria | 20377 |
| 87 | Ga0466690_136970 | 3300042590 | Bacteria | 10441 |
| 88 | Ga0466693_355563 | 3300042592 | Bacteria | 1944 |
| 89 | Ga0466691_027648 | 3300042593 | Bacteria | 8366 |
| 90 | Ga0466691_127107 | 3300042593 | Bacteria | 3387 |
| 91 | Ga0466691_171516 | 3300042593 | Bacteria | 7530 |
| 92 | Ga0466694_004720 | 3300042594 | Bacteria | 8651 |
| 93 | Ga0466696_414157 | 3300042596 | Unclassified | 5088 |
| 94 | Ga0466705_235757 | 3300042612 | Bacteria | 80436 |
| 95 | Ga0466705_382111 | 3300042612 | Bacteria | 4352 |
| 96 | Ga0466732_232028 | 3300042656 | Bacteria | 12386 |
| 97 | Ga0466733_025063 | 3300042659 | Bacteria | 7282 |
| 98 | Ga0123357_10234380 | 3300009784 | Bacteria | 2003 |
| 99 | Ga0123356_10305492 | 3300010049 | Bacteria | 1698 |
| 100 | Ga0123353_10000427 | 3300010167 | Bacteria | 52047 |
| 101 | Ga0123354_10005586 | 3300010882 | Bacteria | 18341 |
| 102 | Ga0466706_055045 | 3300042599 | Bacteria | 47604 |
| 103 | Ga0466713_116118 | 3300042602 | Bacteria | 14615 |
| 104 | Ga0466714_138634 | 3300042603 | Bacteria | 2550 |
| 105 | Ga0466720_027770 | 3300042607 | Bacteria | 36910 |
| 106 | Ga0466720_045361 | 3300042607 | Bacteria | 101316 |
| 107 | Ga0466710_048462 | 3300042613 | Bacteria | 24970 |
| 108 | Ga0466715_084546 | 3300042616 | Bacteria | 2770 |
| 109 | Ga0466718_061397 | 3300042617 | Bacteria | 11265 |
| 110 | 2227164158 | 2225789004 | Bacteria | 8319 |
| 111 | 2227425263 | 2225789004 | Bacteria | 5592 |
| 112 | IMNBGM34_c000118 | 3300000036 | Bacteria | 22722 |
| 113 | JGI24698J34947_10003622 | 3300002449 | Bacteria | 8394 |
| 114 | JGI24698J34947_10004957 | 3300002449 | Unclassified | 7297 |
| 115 | Ga0072941_1000435 | 3300005201 | Bacteria | 27493 |
| 116 | Ga0072941_1012232 | 3300005201 | Bacteria | 35231 |
| 117 | Ga0072941_1132255 | 3300005201 | Bacteria | 1902 |
| 118 | Ga0123357_10000290 | 3300009784 | Bacteria | 48139 |
| 119 | Ga0123357_10002835 | 3300009784 | Bacteria | 19560 |
| 120 | Ga0466729_206171 | 3300042621 | Bacteria | 17094 |
| 121 | Ga0466734_014574 | 3300042623 | Bacteria | 37917 |
| 122 | Ga0466704_179516 | 3300042643 | Bacteria | 6978 |
| 123 | Ga0264413_105364 | 3300024493 | Bacteria | 3479 |
| 124 | Ga0415639_096143 | 3300038395 | Bacteria | 5002 |
| 125 | Ga0466694_383070 | 3300042594 | Bacteria | 2635 |
| 126 | Ga0466696_220453 | 3300042596 | Bacteria | 48351 |
| 127 | Ga0466705_148940 | 3300042612 | Bacteria | 2505 |
| 128 | Ga0466733_096684 | 3300042659 | Bacteria | 2031 |
| 129 | Ga0466733_163075 | 3300042659 | Bacteria | 1506 |
| 130 | Ga0123353_10000496 | 3300010167 | Bacteria | 48699 |
| 131 | Ga0123354_10000141 | 3300010882 | Bacteria | 55442 |
| 132 | Ga0160454_100024 | 3300012798 | Bacteria | 291152 |
| 133 | Ga0160465_102685 | 3300012803 | Bacteria | 3697 |
| 134 | Ga0160464_100644 | 3300012805 | Bacteria | 21664 |
| 135 | Ga0466706_123989 | 3300042599 | Bacteria | 3324 |
| 136 | Ga0466714_084828 | 3300042603 | Bacteria | 27281 |
| 137 | Ga0466719_195650 | 3300042606 | Bacteria | 4576 |
| 138 | Ga0466720_089404 | 3300042607 | Bacteria | 54525 |
| 139 | Ga0466712_018061 | 3300042614 | Bacteria | 22423 |
| 140 | Ga0466711_259965 | 3300042615 | Bacteria | 12270 |
| 141 | Ga0466715_090705 | 3300042616 | Bacteria | 1874 |
| 142 | Ga0466715_244824 | 3300042616 | Bacteria | 35894 |
| 143 | Ga0466718_133967 | 3300042617 | Unclassified | 12107 |
| 144 | Ga0466723_039589 | 3300042618 | Bacteria | 11826 |
| 145 | Ga0466723_133803 | 3300042618 | Bacteria | 8507 |
| 146 | Ga0466726_266592 | 3300042619 | Bacteria | 2365 |
| 147 | Ga0466729_128303 | 3300042621 | Unclassified | 2687 |
| 148 | IMNBL1DRAFT_c0000287 | 3300000062 | Bacteria | 44153 |
| 149 | Ga0072941_1013063 | 3300005201 | Bacteria | 88760 |
| 150 | Ga0102739_1000126 | 3300007095 | Unclassified | 28568 |
| 151 | Ga0102737_1000633 | 3300007142 | Unclassified | 11470 |
| 152 | Ga0466734_001285 | 3300042623 | Bacteria | 6253 |
| 153 | Ga0466703_131665 | 3300042636 | Bacteria | 21166 |
| 154 | Ga0466703_281109 | 3300042636 | Bacteria | 4185 |
| 155 | Ga0466703_389820 | 3300042636 | Bacteria | 23947 |
| 156 | Ga0466708_179569 | 3300042652 | Bacteria | 21735 |
| 157 | Ga0466727_282815 | 3300042655 | Bacteria | 14787 |
| 158 | Ga0466727_294815 | 3300042655 | Bacteria | 6831 |
| 159 | Ga0466657_083943 | 3300042582 | Bacteria | 5735 |
| 160 | Ga0466690_089787 | 3300042590 | Bacteria | 5762 |
| 161 | Ga0466692_161678 | 3300042591 | Bacteria | 2743 |
| 162 | Ga0466694_095164 | 3300042594 | Bacteria | 8956 |
| 163 | Ga0466699_023029 | 3300042597 | Bacteria | 14630 |
| 164 | Ga0590789_03731 | 3300060766 | Bacteria | 1346 |
| 165 | Ga0123357_10010678 | 3300009784 | Bacteria | 11703 |
| 166 | Ga0123357_10172619 | 3300009784 | Bacteria | 2552 |
| 167 | Ga0160471_101246 | 3300012812 | Unclassified | 5306 |
| 168 | Ga0466707_054027 | 3300042601 | Bacteria | 1292 |
| 169 | Ga0466707_144148 | 3300042601 | Bacteria | 33317 |
| 170 | Ga0466717_092404 | 3300042604 | Bacteria | 6591 |
| 171 | Ga0466722_131972 | 3300042609 | Unclassified | 1556 |
| 172 | Ga0466722_133214 | 3300042609 | Bacteria | 21790 |
| 173 | Ga0466710_213729 | 3300042613 | Bacteria | 1785 |
| 174 | Ga0466715_044373 | 3300042616 | Bacteria | 3969 |
| 175 | IMNBGM34_c000347 | 3300000036 | Bacteria | 13318 |
| 176 | JGI24695J34938_10044587 | 3300002450 | Bacteria | 1972 |
| 177 | JGI24702J35022_10017384 | 3300002462 | Bacteria | 3930 |
| 178 | JGI24700J35501_10924400 | 3300002508 | Bacteria | 5463 |
| 179 | Ga0102736_1000005 | 3300007052 | Bacteria | 101322 |
| 180 | Ga0103266_1000020 | 3300007067 | Unclassified | 84543 |
| 181 | Ga0103265_1001587 | 3300007068 | Unclassified | 9970 |
| 182 | Ga0102734_1000108 | 3300007129 | Bacteria | 31109 |
| 183 | Ga0102738_1000029 | 3300007141 | Bacteria | 100132 |
| 184 | Ga0123357_10000234 | 3300009784 | Bacteria | 52576 |
| 185 | Ga0466704_168434 | 3300042643 | Bacteria | 9403 |
| 186 | Ga0466725_093035 | 3300042654 | Bacteria | 14494 |
| 187 | Ga0466725_293742 | 3300042654 | Bacteria | 19643 |
| 188 | Ga0466727_035377 | 3300042655 | Bacteria | 1914 |
| 189 | Ga0160453_100688 | 3300012814 | Bacteria | 20595 |
| 190 | Ga0466657_044496 | 3300042582 | Bacteria | 106333 |
| 191 | Ga0466692_049282 | 3300042591 | Bacteria | 249845 |
| 192 | Ga0466695_321851 | 3300042595 | Bacteria | 6864 |
| 193 | Ga0466696_096221 | 3300042596 | Bacteria | 4011 |
| 194 | Ga0123355_10135972 | 3300009826 | Bacteria | 3775 |
| 195 | Ga0123353_10026987 | 3300010167 | Bacteria | 8789 |
| 196 | Ga0123354_10100685 | 3300010882 | Bacteria | 3909 |
| 197 | Ga0123354_10207393 | 3300010882 | Bacteria | 2131 |
| 198 | Ga0466707_158674 | 3300042601 | Bacteria | 2301 |
| 199 | Ga0466707_235890 | 3300042601 | Bacteria | 12778 |
| 200 | Ga0466713_118697 | 3300042602 | Bacteria | 3070 |
| 201 | Ga0466717_170903 | 3300042604 | Bacteria | 6039 |
| 202 | Ga0466712_012580 | 3300042614 | Bacteria | 15444 |
| 203 | Ga0466712_045057 | 3300042614 | Bacteria | 7547 |
| 204 | Ga0466712_087251 | 3300042614 | Bacteria | 35550 |
| 205 | Ga0466726_058934 | 3300042619 | Bacteria | 8888 |
| 206 | Ga0466726_218918 | 3300042619 | Bacteria | 3906 |
| 207 | Ga0466726_243467 | 3300042619 | Bacteria | 21627 |
| 208 | IMNBGM34_c005869 | 3300000036 | Bacteria | 1609 |
| 209 | AustNasuHG_c1001679 | 3300000089 | Unclassified | 7986 |
| 210 | JGI24695J34938_10000273 | 3300002450 | Bacteria | 50542 |
| 211 | JGI24695J34938_10025770 | 3300002450 | Bacteria | 2805 |
| 212 | Ga0072941_1024312 | 3300005201 | Bacteria | 7726 |
| 213 | Ga0103260_1000030 | 3300007139 | Bacteria | 66904 |
| 214 | Ga0466729_246118 | 3300042621 | Bacteria | 2445 |
| 215 | Ga0466703_023677 | 3300042636 | Bacteria | 8376 |
| 216 | Ga0466704_508939 | 3300042643 | Bacteria | 12922 |
| 217 | Ga0466724_43356 | 3300042649 | Bacteria | 3586 |
| 218 | Ga0466708_201306 | 3300042652 | Bacteria | 23547 |
| 219 | Ga0466725_114107 | 3300042654 | Bacteria | 39880 |
| 220 | Ga0160467_100168 | 3300012829 | Bacteria | 90362 |
| 221 | Ga0264413_105432 | 3300024493 | Unclassified | 4161 |
| 222 | Ga0466705_061380 | 3300042612 | Bacteria | 26546 |
| 223 | Ga0466705_137351 | 3300042612 | Bacteria | 8160 |
| 224 | Ga0590796_00500 | 3300060772 | Unclassified | 3939 |
| 225 | Ga0123357_10010740 | 3300009784 | Bacteria | 11675 |
| 226 | Ga0123356_10010068 | 3300010049 | Bacteria | 9297 |
| 227 | Ga0160470_100040 | 3300012813 | Bacteria | 196297 |
| 228 | Ga0466713_064626 | 3300042602 | Bacteria | 8840 |
| 229 | Ga0466719_030078 | 3300042606 | Bacteria | 26685 |
| 230 | Ga0466722_095550 | 3300042609 | Bacteria | 25610 |
| 231 | Ga0466715_051052 | 3300042616 | Bacteria | 2583 |
| 232 | Ga0466715_420539 | 3300042616 | Bacteria | 1362 |
| 233 | Ga0466718_167671 | 3300042617 | Bacteria | 16721 |
| 234 | Ga0123357_10001076 | 3300009784 | Bacteria | 28163 |
| 235 | Ga0466735_094867 | 3300042624 | Bacteria | 3268 |
| 236 | Ga0466704_060201 | 3300042643 | Bacteria | 120850 |
| 237 | Ga0466704_425493 | 3300042643 | Bacteria | 6690 |
| 238 | Ga0157631_101228 | 3300013007 | Bacteria | 14234 |
| 239 | Ga0466657_224296 | 3300042582 | Unclassified | 3974 |
| 240 | Ga0466692_156686 | 3300042591 | Bacteria | 117611 |
| 241 | Ga0466694_150487 | 3300042594 | Bacteria | 18585 |
| 242 | Ga0466701_009668 | 3300042598 | Bacteria | 4119 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.