Protein Family IF08269
Metagenome
Metatranscriptome
Isolate
217
Members
63
Samples
202
Scaffolds
212.58
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_232238|Ga0466726_232238_101_868
- Length
- 255 aa
- Sequence
- MISAWNTSVRSGQVYSEATQNRRLKGPTHKSFLCLINIGKEKEGMGKLEEIAEAIEGGKSKIIAGLVDEALAAGIDPLKILNEGMIATMGLVGEKFKKAEIFVPEMLVAARAMKKGVEALKPKLASGAATAAGKCIIGTVSGDLHDIGKNLVAMMIESAGFEVIDLGVDVPVDKFIESLKANPDTKVVAVSALLTTTMPAMKDTIATIKASGLKGFKIIIGGAPITQDYANQIGADGYAADAASAAVIAKQFAAA
Sample Types
Isolate
6.9%
Metagenome
90.8%
MAG
0.0%
Metatranscriptome
2.3%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.0%
Unclassified
26.7%
Kalotermitidae
23.3%
Rhinotermitidae
6.7%
Passalidae
5.0%
Termopsidae
3.3%
Taxonomy
Archaea
0
Bacteria
197
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300021221 | Termite gut microbial communities from nest - French Guiana - 18a-5 mRNA SA | Metatranscriptome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 24 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 25 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 26 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 27 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 30 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 31 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 32 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 33 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2820852808 | Unclassified Actinobacteria Lab288P3bin25 | Isolate | Unclassified |
| 38 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 39 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 40 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 43 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 50 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 53 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 59 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 60 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 61 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 62 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 63 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_373275 | 3300042612 | Bacteria | 62368 |
| 2 | Ga0123357_10319428 | 3300009784 | Bacteria | 1536 |
| 3 | Ga0123356_10144421 | 3300010049 | Unclassified | 2352 |
| 4 | Ga0123356_10872605 | 3300010049 | Bacteria | 1071 |
| 5 | Ga0123353_10032287 | 3300010167 | Bacteria | 8128 |
| 6 | Ga0123353_10197240 | 3300010167 | Bacteria | 3172 |
| 7 | Ga0123353_11304572 | 3300010167 | Bacteria | 942 |
| 8 | Ga0123354_10013533 | 3300010882 | Bacteria | 12665 |
| 9 | Ga0466715_575648 | 3300042616 | Bacteria | 10301 |
| 10 | Ga0466726_029991 | 3300042619 | Bacteria | 12210 |
| 11 | Ga0466726_114057 | 3300042619 | Bacteria | 27365 |
| 12 | Ga0466728_002126 | 3300042620 | Bacteria | 2367 |
| 13 | Ga0466728_057678 | 3300042620 | Bacteria | 16762 |
| 14 | Ga0466690_126619 | 3300042590 | Unclassified | 1896 |
| 15 | Ga0466703_069324 | 3300042636 | Bacteria | 15430 |
| 16 | 2227296072 | 2225789004 | Bacteria | 1231 |
| 17 | 2227580176 | 2225789004 | Bacteria | 13436 |
| 18 | IMNBL1DRAFT_c0000007 | 3300000062 | Bacteria | 246638 |
| 19 | IMNBL1DRAFT_c0061495 | 3300000062 | Unclassified | 1126 |
| 20 | JGI24702J35022_10202888 | 3300002462 | Bacteria | 1136 |
| 21 | JGI24702J35022_10231322 | 3300002462 | Bacteria | 1069 |
| 22 | Ga0466716_007715 | 3300042605 | Unclassified | 4679 |
| 23 | Ga0466719_088309 | 3300042606 | Bacteria | 60348 |
| 24 | Ga0466719_212929 | 3300042606 | Bacteria | 5240 |
| 25 | Ga0123356_10461795 | 3300010049 | Bacteria | 1420 |
| 26 | Ga0123356_10949052 | 3300010049 | Bacteria | 1031 |
| 27 | Ga0123353_10201227 | 3300010167 | Unclassified | 3133 |
| 28 | Ga0123353_10312132 | 3300010167 | Bacteria | 2392 |
| 29 | Ga0123353_10347508 | 3300010167 | Bacteria | 2237 |
| 30 | Ga0466711_221526 | 3300042615 | Bacteria | 17842 |
| 31 | Ga0466711_255651 | 3300042615 | Bacteria | 3752 |
| 32 | Ga0466715_361094 | 3300042616 | Bacteria | 7675 |
| 33 | Ga0466723_270483 | 3300042618 | Bacteria | 27344 |
| 34 | Ga0466726_232238 | 3300042619 | Bacteria | 6978 |
| 35 | Ga0466726_440904 | 3300042619 | Bacteria | 6331 |
| 36 | Ga0466692_125006 | 3300042591 | Bacteria | 40169 |
| 37 | Ga0466729_304079 | 3300042621 | Bacteria | 1780 |
| 38 | Ga0466703_176156 | 3300042636 | Bacteria | 14027 |
| 39 | Ga0466704_298844 | 3300042643 | Bacteria | 16621 |
| 40 | Ga0466725_263191 | 3300042654 | Bacteria | 1114 |
| 41 | Ga0466727_120644 | 3300042655 | Bacteria | 16603 |
| 42 | 2227473798 | 2225789004 | Bacteria | 4746 |
| 43 | IMNBL1DRAFT_c0000980 | 3300000062 | Bacteria | 22025 |
| 44 | JGI24702J35022_10016333 | 3300002462 | Bacteria | 4069 |
| 45 | JGI24702J35022_10041631 | 3300002462 | Bacteria | 2448 |
| 46 | JGI24702J35022_10171632 | 3300002462 | Bacteria | 1227 |
| 47 | JGI24702J35022_10310941 | 3300002462 | Unclassified | 932 |
| 48 | JGI24696J40584_12943706 | 3300002834 | Bacteria | 1784 |
| 49 | Ga0466707_132698 | 3300042601 | Bacteria | 8128 |
| 50 | Ga0466713_053218 | 3300042602 | Bacteria | 7178 |
| 51 | Ga0466716_378628 | 3300042605 | Bacteria | 2828 |
| 52 | Ga0466721_101079 | 3300042608 | Bacteria | 47034 |
| 53 | Ga0466722_106548 | 3300042609 | Bacteria | 5064 |
| 54 | Ga0466722_214107 | 3300042609 | Bacteria | 6309 |
| 55 | Ga0466697_198894 | 3300042611 | Unclassified | 2619 |
| 56 | Ga0123357_10017596 | 3300009784 | Bacteria | 9467 |
| 57 | Ga0123356_10095058 | 3300010049 | Bacteria | 2848 |
| 58 | Ga0123356_10414797 | 3300010049 | Bacteria | 1487 |
| 59 | Ga0123356_11104812 | 3300010049 | Bacteria | 961 |
| 60 | Ga0123353_10006611 | 3300010167 | Bacteria | 15480 |
| 61 | Ga0123353_10083254 | 3300010167 | Bacteria | 5147 |
| 62 | Ga0123353_10199111 | 3300010167 | Bacteria | 3153 |
| 63 | Ga0123353_10273506 | 3300010167 | Bacteria | 2600 |
| 64 | Ga0123353_10560383 | 3300010167 | Bacteria | 1645 |
| 65 | Ga0466726_077531 | 3300042619 | Bacteria | 7598 |
| 66 | Ga0466726_175488 | 3300042619 | Bacteria | 1129 |
| 67 | Ga0466726_257267 | 3300042619 | Bacteria | 9237 |
| 68 | Ga0466728_337047 | 3300042620 | Unclassified | 11121 |
| 69 | Ga0223689_101653 | 3300021221 | Bacteria | 821 |
| 70 | Ga0456237_0017804 | 3300041968 | Bacteria | 995 |
| 71 | Ga0466691_146563 | 3300042593 | Bacteria | 10255 |
| 72 | Ga0466699_269782 | 3300042597 | Bacteria | 1075 |
| 73 | Ga0466734_081967 | 3300042623 | Bacteria | 3162 |
| 74 | Ga0466703_282024 | 3300042636 | Bacteria | 15718 |
| 75 | Ga0466727_225071 | 3300042655 | Bacteria | 1079 |
| 76 | IMNBL1DRAFT_c0000157 | 3300000062 | Bacteria | 60406 |
| 77 | JGI24702J35022_10024475 | 3300002462 | Bacteria | 3262 |
| 78 | JGI24705J35276_12148314 | 3300002504 | Bacteria | 1171 |
| 79 | Ga0466700_411945 | 3300042600 | Bacteria | 5558 |
| 80 | Ga0466700_483918 | 3300042600 | Bacteria | 2111 |
| 81 | Ga0466707_384531 | 3300042601 | Bacteria | 41166 |
| 82 | Ga0466713_118159 | 3300042602 | Bacteria | 4866 |
| 83 | Ga0466717_054479 | 3300042604 | Bacteria | 1406 |
| 84 | Ga0466719_095561 | 3300042606 | Bacteria | 1026 |
| 85 | Ga0466705_351176 | 3300042612 | Bacteria | 5619 |
| 86 | Ga0123355_10361974 | 3300009826 | Bacteria | 1910 |
| 87 | Ga0123355_11167708 | 3300009826 | Bacteria | 791 |
| 88 | Ga0123356_10069417 | 3300010049 | Bacteria | 3304 |
| 89 | Ga0123356_10074261 | 3300010049 | Bacteria | 3199 |
| 90 | Ga0123356_10296388 | 3300010049 | Bacteria | 1720 |
| 91 | Ga0123353_10045367 | 3300010167 | Bacteria | 6974 |
| 92 | Ga0123353_10048033 | 3300010167 | Unclassified | 6793 |
| 93 | Ga0123353_10060890 | 3300010167 | Bacteria | 6053 |
| 94 | Ga0123353_10076367 | 3300010167 | Unclassified | 5383 |
| 95 | Ga0123353_10370523 | 3300010167 | Bacteria | 2147 |
| 96 | Ga0466726_045989 | 3300042619 | Bacteria | 5925 |
| 97 | Ga0255809_1101813 | 3300022820 | Bacteria | 792 |
| 98 | Ga0466691_122624 | 3300042593 | Bacteria | 8964 |
| 99 | Ga0466696_438240 | 3300042596 | Bacteria | 19441 |
| 100 | Ga0466708_289887 | 3300042652 | Bacteria | 1997 |
| 101 | Ga0466725_030778 | 3300042654 | Bacteria | 1316 |
| 102 | Ga0466727_016133 | 3300042655 | Bacteria | 1313 |
| 103 | JGI24695J34938_10000057 | 3300002450 | Bacteria | 89669 |
| 104 | JGI24702J35022_10074523 | 3300002462 | Bacteria | 1832 |
| 105 | Ga0466700_397829 | 3300042600 | Bacteria | 1487 |
| 106 | Ga0466707_230610 | 3300042601 | Bacteria | 6120 |
| 107 | Ga0466707_421297 | 3300042601 | Bacteria | 2279 |
| 108 | Ga0466717_190272 | 3300042604 | Unclassified | 1134 |
| 109 | Ga0466719_025025 | 3300042606 | Bacteria | 3833 |
| 110 | Ga0466719_283489 | 3300042606 | Bacteria | 2575 |
| 111 | Ga0466721_370288 | 3300042608 | Bacteria | 44975 |
| 112 | Ga0466722_075092 | 3300042609 | Bacteria | 6401 |
| 113 | Ga0123356_10309679 | 3300010049 | Bacteria | 1688 |
| 114 | Ga0123356_10315616 | 3300010049 | Bacteria | 1674 |
| 115 | Ga0123356_11761598 | 3300010049 | Bacteria | 769 |
| 116 | Ga0123353_10169371 | 3300010167 | Bacteria | 3468 |
| 117 | Ga0123353_10198921 | 3300010167 | Bacteria | 3155 |
| 118 | Ga0123353_10231603 | 3300010167 | Bacteria | 2879 |
| 119 | Ga0123354_10306540 | 3300010882 | Bacteria | 1492 |
| 120 | Ga0123354_10383562 | 3300010882 | Unclassified | 1210 |
| 121 | Ga0466711_075763 | 3300042615 | Bacteria | 9352 |
| 122 | Ga0466711_117777 | 3300042615 | Bacteria | 7033 |
| 123 | Ga0466715_303527 | 3300042616 | Bacteria | 6343 |
| 124 | Ga0466723_119901 | 3300042618 | Bacteria | 15238 |
| 125 | Ga0466726_167843 | 3300042619 | Bacteria | 6579 |
| 126 | Ga0466726_479740 | 3300042619 | Bacteria | 1805 |
| 127 | Ga0466728_247293 | 3300042620 | Bacteria | 7989 |
| 128 | Ga0466729_163764 | 3300042621 | Bacteria | 2516 |
| 129 | Ga0223677_1004652 | 3300021239 | Bacteria | 1276 |
| 130 | Ga0255809_1009062 | 3300022820 | Bacteria | 1071 |
| 131 | Ga0466692_035366 | 3300042591 | Bacteria | 24549 |
| 132 | Ga0466729_308034 | 3300042621 | Bacteria | 5852 |
| 133 | Ga0466734_134972 | 3300042623 | Bacteria | 1624 |
| 134 | Ga0466702_267346 | 3300042635 | Bacteria | 2452 |
| 135 | Ga0466727_220510 | 3300042655 | Bacteria | 8988 |
| 136 | JGI24705J35276_12227902 | 3300002504 | Bacteria | 3087 |
| 137 | Ga0068305_10008099 | 3300005083 | Bacteria | 232741 |
| 138 | Ga0466719_098916 | 3300042606 | Bacteria | 1335 |
| 139 | Ga0123356_10832946 | 3300010049 | Bacteria | 1094 |
| 140 | Ga0123353_10252781 | 3300010167 | Bacteria | 2728 |
| 141 | Ga0123353_11310676 | 3300010167 | Bacteria | 939 |
| 142 | Ga0123353_11635203 | 3300010167 | Unclassified | 811 |
| 143 | Ga0466705_427488 | 3300042612 | Unclassified | 2166 |
| 144 | Ga0466711_316885 | 3300042615 | Bacteria | 3138 |
| 145 | Ga0466715_463809 | 3300042616 | Bacteria | 2692 |
| 146 | Ga0466723_291648 | 3300042618 | Bacteria | 1449 |
| 147 | Ga0466703_323705 | 3300042636 | Bacteria | 10503 |
| 148 | Ga0466704_279696 | 3300042643 | Bacteria | 9148 |
| 149 | Ga0466709_044265 | 3300042648 | Bacteria | 27868 |
| 150 | Ga0466709_196528 | 3300042648 | Bacteria | 9379 |
| 151 | Ga0466727_266394 | 3300042655 | Bacteria | 2657 |
| 152 | Ga0466727_312674 | 3300042655 | Unclassified | 1548 |
| 153 | JGI24702J35022_10002033 | 3300002462 | Bacteria | 12465 |
| 154 | JGI24702J35022_10295631 | 3300002462 | Unclassified | 954 |
| 155 | Ga0466719_019842 | 3300042606 | Bacteria | 6981 |
| 156 | Ga0466719_086308 | 3300042606 | Bacteria | 21064 |
| 157 | Ga0123356_10143663 | 3300010049 | Bacteria | 2358 |
| 158 | Ga0123356_10422829 | 3300010049 | Bacteria | 1475 |
| 159 | Ga0123353_10893995 | 3300010167 | Bacteria | 1210 |
| 160 | Ga0466715_218169 | 3300042616 | Bacteria | 6505 |
| 161 | Ga0466726_296723 | 3300042619 | Bacteria | 1942 |
| 162 | Ga0466726_341579 | 3300042619 | Bacteria | 1169 |
| 163 | Ga0466728_120274 | 3300042620 | Bacteria | 2036 |
| 164 | Ga0223674_1039021 | 3300021235 | Bacteria | 977 |
| 165 | Ga0466692_077672 | 3300042591 | Bacteria | 18482 |
| 166 | Ga0466696_062453 | 3300042596 | Bacteria | 2064 |
| 167 | Ga0466696_374707 | 3300042596 | Bacteria | 12286 |
| 168 | Ga0466704_061351 | 3300042643 | Bacteria | 5899 |
| 169 | Ga0466727_115845 | 3300042655 | Bacteria | 1550 |
| 170 | Ga0466727_201626 | 3300042655 | Bacteria | 1311 |
| 171 | 2226998161 | 2225789003 | Unclassified | 1386 |
| 172 | JGI24702J35022_10031579 | 3300002462 | Bacteria | 2837 |
| 173 | Ga0466707_011789 | 3300042601 | Bacteria | 1689 |
| 174 | Ga0466707_246448 | 3300042601 | Bacteria | 2526 |
| 175 | Ga0466722_176099 | 3300042609 | Bacteria | 6411 |
| 176 | Ga0466705_345259 | 3300042612 | Unclassified | 2519 |
| 177 | Ga0123357_10007271 | 3300009784 | Bacteria | 13659 |
| 178 | Ga0123356_10174126 | 3300010049 | Bacteria | 2166 |
| 179 | Ga0123356_10300631 | 3300010049 | Bacteria | 1709 |
| 180 | Ga0123353_10117584 | 3300010167 | Bacteria | 4276 |
| 181 | Ga0123353_10220527 | 3300010167 | Bacteria | 2965 |
| 182 | Ga0466705_392247 | 3300042612 | Bacteria | 4212 |
| 183 | Ga0466711_016489 | 3300042615 | Bacteria | 9628 |
| 184 | Ga0466726_042716 | 3300042619 | Bacteria | 2351 |
| 185 | Ga0466726_079305 | 3300042619 | Bacteria | 3584 |
| 186 | Ga0466726_145129 | 3300042619 | Bacteria | 2793 |
| 187 | Ga0466728_132470 | 3300042620 | Bacteria | 4945 |
| 188 | Ga0415639_022702 | 3300038395 | Bacteria | 6742 |
| 189 | Ga0466690_300118 | 3300042590 | Bacteria | 21947 |
| 190 | Ga0466691_042463 | 3300042593 | Bacteria | 1559 |
| 191 | Ga0466694_395646 | 3300042594 | Bacteria | 3141 |
| 192 | Ga0466696_011725 | 3300042596 | Bacteria | 2872 |
| 193 | Ga0466734_158218 | 3300042623 | Bacteria | 2251 |
| 194 | Ga0466704_299506 | 3300042643 | Unclassified | 14693 |
| 195 | JGI24702J35022_10000060 | 3300002462 | Bacteria | 46212 |
| 196 | JGI24702J35022_10001069 | 3300002462 | Bacteria | 17065 |
| 197 | JGI24702J35022_10006739 | 3300002462 | Bacteria | 6620 |
| 198 | JGI24702J35022_10025716 | 3300002462 | Bacteria | 3174 |
| 199 | Ga0072941_1116512 | 3300005201 | Unclassified | 2911 |
| 200 | Ga0466719_064021 | 3300042606 | Bacteria | 17950 |
| 201 | Ga0466722_072010 | 3300042609 | Bacteria | 1613 |
| 202 | Ga0466722_164881 | 3300042609 | Bacteria | 2655 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.