Protein Family IF08244
Metagenome
Isolate
158
Members
78
Samples
135
Scaffolds
461.01
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_151678|Ga0466726_151678_622_2157
- Length
- 511 aa
- Sequence
- LQQRHKTLIYYFNNFKKTTNMKVKQSMTRRNFLATSGAALVGSVLINPASELRAATAVTSPRQAKDGLKLAMVGTGSRGTSMWGRGLTERYPEIKFVGLCDSNPGRVEAGREIIGANCPTYSDLKNPMAAFEKMIAETKPDMLVVTTVDATHNEYIVRGMELGVNVLTEKPMTTDEAKVQQILDAEKRTGRKTRVTFNYRYSPHRAKIWELLRAGEIGELTSVDFHWYLDTRHGADYFRRWHRLVEKSGSLWVHKASHHFDLLNWWIDSDPETVYALGSLDFYGKNGTYRAENCRTCPHTQTCPFYFQLDRPIMSAAMQDAAGVNRQAAFVNPYKRLYIDCEQHDGYLRDGCVFKNDINIFDKMAATIKYANGVQVAYSLTAYSPYEGYRIAFNGTKGRLDAWIQESNPMQDRDYDEIVLFKNFSRRQYIQIPYGTSGHGGGDDLLRDQIFIPGTPDPLKQCAGTRDGAFACLIGIAARNSIASAQPVKIADLTSLRPQAQKEYQRDIMGM
Sample Types
Isolate
14.6%
Metagenome
85.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.0%
Blattidae
25.7%
Kalotermitidae
18.9%
Armadillidiidae
5.4%
Rhinotermitidae
5.4%
Termopsidae
5.4%
Unclassified
4.1%
Passalidae
2.7%
Drosophilidae
1.4%
Culicidae
1.4%
Daphniidae
1.4%
Scarabaeidae
1.4%
Taxonomy
Archaea
0
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 2 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 3 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 11 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 16 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 17 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 18 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 19 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 26 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 27 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 28 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 29 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 30 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 31 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 32 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 33 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 42 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 45 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 46 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 47 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 53 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 54 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 55 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 56 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 57 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 58 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 59 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 60 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 61 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 62 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 63 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 64 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 65 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 66 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 67 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 68 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 69 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 70 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 71 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 72 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 73 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 74 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 75 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 76 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 77 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 78 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_201662 | 3300042612 | Bacteria | 6224 |
| 2 | Ga0466733_183414 | 3300042659 | Bacteria | 71919 |
| 3 | Ga0466701_026085 | 3300042598 | Bacteria | 5920 |
| 4 | Ga0466707_022979 | 3300042601 | Bacteria | 9879 |
| 5 | Ga0466707_225866 | 3300042601 | Bacteria | 5232 |
| 6 | Ga0466714_033894 | 3300042603 | Bacteria | 61713 |
| 7 | Ga0466716_484837 | 3300042605 | Bacteria | 30730 |
| 8 | Ga0466719_177993 | 3300042606 | Bacteria | 4055 |
| 9 | Ga0466719_323893 | 3300042606 | Bacteria | 3147 |
| 10 | Ga0466719_454950 | 3300042606 | Bacteria | 2008 |
| 11 | Ga0466703_079251 | 3300042636 | Bacteria | 4119 |
| 12 | Ga0466704_150943 | 3300042643 | Bacteria | 32243 |
| 13 | Ga0466704_505246 | 3300042643 | Bacteria | 9861 |
| 14 | Ga0466725_359981 | 3300042654 | Bacteria | 5122 |
| 15 | Ga0466715_074218 | 3300042616 | Bacteria | 18263 |
| 16 | Ga0466726_307227 | 3300042619 | Bacteria | 8546 |
| 17 | Ga0466728_361802 | 3300042620 | Bacteria | 2750 |
| 18 | Ga0123356_10055686 | 3300010049 | Bacteria | 3684 |
| 19 | Ga0123353_10494356 | 3300010167 | Bacteria | 1785 |
| 20 | Ga0265387_1002894 | 3300024582 | Bacteria | 2401 |
| 21 | Ga0265387_1007015 | 3300024582 | Bacteria | 1511 |
| 22 | Ga0466657_389886 | 3300042582 | Bacteria | 3677 |
| 23 | Ga0466691_101293 | 3300042593 | Bacteria | 13506 |
| 24 | JGI24705J35276_12238552 | 3300002504 | Bacteria | 26267 |
| 25 | Ga0072941_1020973 | 3300005201 | Bacteria | 68603 |
| 26 | Ga0466697_238690 | 3300042611 | Bacteria | 1969 |
| 27 | Ga0466733_192917 | 3300042659 | Bacteria | 71960 |
| 28 | Ga0466713_044941 | 3300042602 | Bacteria | 1976 |
| 29 | Ga0466734_039167 | 3300042623 | Bacteria | 2871 |
| 30 | Ga0466708_129066 | 3300042652 | Bacteria | 5993 |
| 31 | Ga0466708_208740 | 3300042652 | Bacteria | 4905 |
| 32 | Ga0466711_458035 | 3300042615 | Bacteria | 14701 |
| 33 | Ga0466715_015236 | 3300042616 | Bacteria | 24756 |
| 34 | Ga0466723_029164 | 3300042618 | Bacteria | 16365 |
| 35 | Ga0466728_008122 | 3300042620 | Bacteria | 3841 |
| 36 | Ga0160466_100795 | 3300012809 | Bacteria | 12273 |
| 37 | Ga0160468_100160 | 3300012819 | Bacteria | 53120 |
| 38 | Ga0466690_085973 | 3300042590 | Bacteria | 8307 |
| 39 | Ga0466692_161211 | 3300042591 | Bacteria | 49415 |
| 40 | 2227652413 | 2225789004 | Bacteria | 10718 |
| 41 | JGI24702J35022_10020751 | 3300002462 | Bacteria | 3563 |
| 42 | JGI24702J35022_10053439 | 3300002462 | Unclassified | 2154 |
| 43 | Ga0466705_110830 | 3300042612 | Bacteria | 8898 |
| 44 | Ga0466733_215275 | 3300042659 | Bacteria | 11360 |
| 45 | Ga0466713_118877 | 3300042602 | Bacteria | 3348 |
| 46 | Ga0466714_032700 | 3300042603 | Bacteria | 6303 |
| 47 | Ga0466731_270234 | 3300042622 | Bacteria | 2094 |
| 48 | Ga0466703_262761 | 3300042636 | Bacteria | 4585 |
| 49 | Ga0466704_222943 | 3300042643 | Bacteria | 11416 |
| 50 | Ga0466708_072141 | 3300042652 | Bacteria | 7571 |
| 51 | Ga0466708_254262 | 3300042652 | Bacteria | 30960 |
| 52 | Ga0466727_290618 | 3300042655 | Bacteria | 84490 |
| 53 | Ga0466711_178173 | 3300042615 | Bacteria | 4517 |
| 54 | Ga0466711_404115 | 3300042615 | Bacteria | 44506 |
| 55 | Ga0466715_008279 | 3300042616 | Bacteria | 34287 |
| 56 | Ga0466729_091329 | 3300042621 | Bacteria | 4338 |
| 57 | Ga0123353_10038277 | 3300010167 | Bacteria | 7537 |
| 58 | IMNBL1DRAFT_c0005132 | 3300000062 | Bacteria | 7610 |
| 59 | Ga0068302_10215373 | 3300005071 | Bacteria | 3579 |
| 60 | Ga0072941_1201102 | 3300005201 | Bacteria | 2151 |
| 61 | Ga0466705_286980 | 3300042612 | Bacteria | 27218 |
| 62 | Ga0466733_217303 | 3300042659 | Bacteria | 2282 |
| 63 | Ga0466719_298493 | 3300042606 | Bacteria | 1556 |
| 64 | Ga0466709_020733 | 3300042648 | Bacteria | 48670 |
| 65 | Ga0466708_149614 | 3300042652 | Bacteria | 33318 |
| 66 | Ga0466715_038341 | 3300042616 | Bacteria | 16679 |
| 67 | Ga0466715_065052 | 3300042616 | Bacteria | 1717 |
| 68 | Ga0466715_286685 | 3300042616 | Bacteria | 27433 |
| 69 | Ga0466726_151678 | 3300042619 | Bacteria | 3147 |
| 70 | Ga0466728_454354 | 3300042620 | Bacteria | 18234 |
| 71 | Ga0123353_10060772 | 3300010167 | Bacteria | 6059 |
| 72 | Ga0160445_101833 | 3300012847 | Bacteria | 5471 |
| 73 | Ga0466690_402356 | 3300042590 | Bacteria | 64397 |
| 74 | Ga0466705_261600 | 3300042612 | Bacteria | 9653 |
| 75 | Ga0466701_080415 | 3300042598 | Bacteria | 4287 |
| 76 | Ga0466716_376714 | 3300042605 | Bacteria | 8728 |
| 77 | Ga0466735_008785 | 3300042624 | Bacteria | 7437 |
| 78 | Ga0466703_191485 | 3300042636 | Bacteria | 7980 |
| 79 | Ga0466704_450967 | 3300042643 | Bacteria | 8239 |
| 80 | Ga0466725_165576 | 3300042654 | Bacteria | 35468 |
| 81 | Ga0466718_112585 | 3300042617 | Bacteria | 2635 |
| 82 | Ga0123354_10208188 | 3300010882 | Bacteria | 2124 |
| 83 | Ga0160470_100059 | 3300012813 | Bacteria | 159194 |
| 84 | Ga0466690_218264 | 3300042590 | Bacteria | 18957 |
| 85 | Ga0466693_245962 | 3300042592 | Unclassified | 5453 |
| 86 | Ga0466694_354079 | 3300042594 | Bacteria | 2226 |
| 87 | Ga0466697_186481 | 3300042611 | Bacteria | 27325 |
| 88 | Ga0466701_072680 | 3300042598 | Bacteria | 34156 |
| 89 | Ga0466722_039133 | 3300042609 | Bacteria | 10795 |
| 90 | Ga0466722_173318 | 3300042609 | Bacteria | 10485 |
| 91 | Ga0466735_008353 | 3300042624 | Bacteria | 1797 |
| 92 | Ga0466704_119635 | 3300042643 | Bacteria | 13895 |
| 93 | Ga0466711_342049 | 3300042615 | Bacteria | 11183 |
| 94 | Ga0123354_10082162 | 3300010882 | Bacteria | 4544 |
| 95 | Ga0160452_100344 | 3300012834 | Bacteria | 39822 |
| 96 | Ga0466693_136038 | 3300042592 | Bacteria | 1273 |
| 97 | JGI24699J35502_11133800 | 3300002509 | Bacteria | 15831 |
| 98 | JGI24696J40584_12958454 | 3300002834 | Bacteria | 4153 |
| 99 | Ga0466697_165305 | 3300042611 | Bacteria | 1440 |
| 100 | Ga0466717_069287 | 3300042604 | Bacteria | 2455 |
| 101 | Ga0466735_128473 | 3300042624 | Bacteria | 3633 |
| 102 | Ga0466704_155985 | 3300042643 | Unclassified | 13710 |
| 103 | Ga0466704_575886 | 3300042643 | Bacteria | 3625 |
| 104 | Ga0466709_066569 | 3300042648 | Bacteria | 14891 |
| 105 | Ga0466727_252848 | 3300042655 | Bacteria | 2103 |
| 106 | Ga0466715_006176 | 3300042616 | Bacteria | 25661 |
| 107 | Ga0123353_10363541 | 3300010167 | Bacteria | 2173 |
| 108 | Ga0160433_100166 | 3300012846 | Bacteria | 55536 |
| 109 | Ga0466656_042995 | 3300042550 | Bacteria | 2121 |
| 110 | Ga0466656_203770 | 3300042550 | Unclassified | 2775 |
| 111 | Ga0466690_341657 | 3300042590 | Bacteria | 12470 |
| 112 | Ga0466691_039152 | 3300042593 | Bacteria | 2878 |
| 113 | Ga0466696_058652 | 3300042596 | Bacteria | 8803 |
| 114 | Ga0466696_431143 | 3300042596 | Bacteria | 6543 |
| 115 | 2227581849 | 2225789004 | Bacteria | 2503 |
| 116 | 2227601855 | 2225789004 | Bacteria | 2330 |
| 117 | IMNBL1DRAFT_c0000127 | 3300000062 | Bacteria | 67907 |
| 118 | JGI24702J35022_10007701 | 3300002462 | Bacteria | 6150 |
| 119 | Ga0466705_032077 | 3300042612 | Bacteria | 35827 |
| 120 | Ga0466707_089281 | 3300042601 | Bacteria | 15760 |
| 121 | Ga0466722_084946 | 3300042609 | Bacteria | 11980 |
| 122 | Ga0466704_222113 | 3300042643 | Bacteria | 2352 |
| 123 | Ga0466709_145891 | 3300042648 | Bacteria | 8479 |
| 124 | Ga0466715_455126 | 3300042616 | Bacteria | 17407 |
| 125 | Ga0466715_470418 | 3300042616 | Bacteria | 18054 |
| 126 | Ga0466726_214397 | 3300042619 | Bacteria | 3117 |
| 127 | Ga0466728_030334 | 3300042620 | Bacteria | 9746 |
| 128 | Ga0123353_10266112 | 3300010167 | Bacteria | 2645 |
| 129 | Ga0160467_100796 | 3300012829 | Bacteria | 21233 |
| 130 | Ga0466692_115633 | 3300042591 | Bacteria | 15537 |
| 131 | Ga0466696_005686 | 3300042596 | Bacteria | 4170 |
| 132 | JGI24702J35022_10010809 | 3300002462 | Bacteria | 5093 |
| 133 | JGI24702J35022_10012058 | 3300002462 | Bacteria | 4812 |
| 134 | Ga0068302_10061352 | 3300005071 | Unclassified | 5292 |
| 135 | Ga0105005_1018018 | 3300007505 | Bacteria | 2912 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01408 | GO:0000166 | nucleotide binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.