Protein Family IF08186
Metagenome
Isolate
172
Members
98
Samples
140
Scaffolds
398.36
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_005761|Ga0466726_005761_317_1705
- Length
- 462 aa
- Sequence
- LKVTLQFFHKPQVIVNVTMFPPKMKGDAVKNFAVCTLVPPTVLYISWYYCKAIKFDLSATKVRKIIMSIGVSKIIQGLEPSATLAMSAKAKELKAQGKTVYDLSVGEPDFVTPQHICDAGTVAMKAGHTKYTIASGIPELKKAIAEKYKADYGLEYAPSQIVISNGAKHSLHNAFFTTLDPGDEVIIPAPYWVSYAELVKLSGAVPVIVPTEESQNFKMPVAQFEKAITPKTKMLLLCSPSNPTGAMYSGDELRAIADIVLQKSLFVVADEIYDKLVYGSNKFVSFPTLRSGLQDRTIVVNGASKTYAMTGWRVGWTFSPENVAKKMGELQSQETSNPCSISQYAALAALTGSQDCVAKMLTAFTERRDYVAKRIAGIDGLSCPEMSGAFYAFFNIKKHLGRKLDGVLIHNSEQFCLELLTQKQVATVMGSSFGCEGYVRASFAAGIDILKTAFDRIAEFVS
Sample Types
Isolate
18.6%
Metagenome
81.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
21.3%
Drosophilidae
20.2%
Kalotermitidae
14.6%
Armadillidiidae
10.1%
Unclassified
10.1%
Culicidae
6.7%
Formicidae
4.5%
Rhinotermitidae
3.4%
Termopsidae
3.4%
Passalidae
1.1%
Daphniidae
1.1%
Hydrophilidae
1.1%
Bombycidae
1.1%
Muscidae
1.1%
Taxonomy
Archaea
1
Bacteria
158
Eukaryota
4
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 2 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 6 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 7 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 15 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 16 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 17 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 18 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 19 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 23 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 24 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 25 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 26 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 27 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 28 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 29 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 30 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 31 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 32 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 33 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 34 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 35 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 36 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 37 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 38 | 2820196379 | Unclassified Planctomycetes Emb289P3bin158 | Isolate | Unclassified |
| 39 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 40 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 47 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 48 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 49 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 50 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 51 | 2820611732 | Unclassified Firmicutes Emb289P1bin19 | Isolate | Unclassified |
| 52 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 53 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 54 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 55 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 56 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 57 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 58 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 59 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 60 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 61 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 62 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 63 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 64 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 65 | 2987037630 | Oecophyllibacter saccharovorans Ha5 | Isolate | Formicidae |
| 66 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 67 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 68 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 69 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 70 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 71 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 72 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 73 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 74 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 75 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 76 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 77 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 78 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 79 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 80 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 81 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 82 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 83 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 84 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 85 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 86 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 87 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 88 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 89 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 90 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 91 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 92 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 93 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 94 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 95 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 96 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 97 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 98 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_020516 | 3300042615 | Bacteria | 6199 |
| 2 | Ga0466723_110837 | 3300042618 | Bacteria | 15054 |
| 3 | Ga0466726_395472 | 3300042619 | Bacteria | 1800 |
| 4 | Ga0123356_10218487 | 3300010049 | Archaea | 1960 |
| 5 | Ga0123353_10005109 | 3300010167 | Bacteria | 17134 |
| 6 | Ga0123353_10007931 | 3300010167 | Bacteria | 14437 |
| 7 | Ga0160453_100400 | 3300012814 | Bacteria | 36021 |
| 8 | Ga0160434_100055 | 3300012850 | Bacteria | 84316 |
| 9 | Ga0160457_1000001 | 3300012858 | Bacteria | 1192173 |
| 10 | Ga0466693_118243 | 3300042592 | Bacteria | 2980 |
| 11 | Ga0466722_019761 | 3300042609 | Bacteria | 8416 |
| 12 | Ga0466731_135492 | 3300042622 | Bacteria | 3242 |
| 13 | Ga0466703_341757 | 3300042636 | Bacteria | 3131 |
| 14 | Ga0466704_026916 | 3300042643 | Bacteria | 143520 |
| 15 | Ga0466709_073055 | 3300042648 | Bacteria | 1717 |
| 16 | Ga0466727_244961 | 3300042655 | Bacteria | 6303 |
| 17 | IMNBGM34_c002217 | 3300000036 | Bacteria | 2915 |
| 18 | Ga0102740_1000111 | 3300007140 | Bacteria | 20936 |
| 19 | Ga0466729_018888 | 3300042621 | Bacteria | 13239 |
| 20 | Ga0123353_10041105 | 3300010167 | Bacteria | 7300 |
| 21 | Ga0160453_100001 | 3300012814 | Bacteria | 1272344 |
| 22 | Ga0160459_100023 | 3300012831 | Bacteria | 364187 |
| 23 | Ga0160443_100148 | 3300012848 | Bacteria | 101089 |
| 24 | Ga0160457_1001994 | 3300012858 | Bacteria | 4807 |
| 25 | Ga0466691_190578 | 3300042593 | Bacteria | 5530 |
| 26 | Ga0072941_1159105 | 3300005201 | Bacteria | 8393 |
| 27 | Ga0072941_1180113 | 3300005201 | Bacteria | 3049 |
| 28 | Ga0466711_143912 | 3300042615 | Bacteria | 2544 |
| 29 | Ga0123356_10025456 | 3300010049 | Bacteria | 5562 |
| 30 | Ga0123353_10711961 | 3300010167 | Bacteria | 1406 |
| 31 | Ga0160468_100143 | 3300012819 | Bacteria | 66884 |
| 32 | Ga0160472_100010 | 3300012839 | Bacteria | 466892 |
| 33 | Ga0415639_246503 | 3300038395 | Eukaryota | 1732 |
| 34 | Ga0466694_096380 | 3300042594 | Bacteria | 1665 |
| 35 | Ga0466699_035867 | 3300042597 | Bacteria | 1969 |
| 36 | Ga0466701_074000 | 3300042598 | Bacteria | 2183 |
| 37 | Ga0466716_342359 | 3300042605 | Bacteria | 4684 |
| 38 | Ga0466729_251879 | 3300042621 | Bacteria | 3793 |
| 39 | Ga0466734_030427 | 3300042623 | Bacteria | 4637 |
| 40 | Ga0466703_064559 | 3300042636 | Bacteria | 1578 |
| 41 | Ga0466724_08873 | 3300042649 | Unclassified | 5233 |
| 42 | Ga0466708_163601 | 3300042652 | Bacteria | 33774 |
| 43 | JGI24702J35022_10037433 | 3300002462 | Bacteria | 2591 |
| 44 | Ga0104048_1022249 | 3300007143 | Bacteria | 5721 |
| 45 | Ga0466723_371180 | 3300042618 | Bacteria | 15144 |
| 46 | Ga0123355_10020085 | 3300009826 | Bacteria | 10654 |
| 47 | Ga0123353_10002117 | 3300010167 | Bacteria | 24550 |
| 48 | Ga0123353_10311943 | 3300010167 | Bacteria | 2393 |
| 49 | Ga0160467_100463 | 3300012829 | Unclassified | 39684 |
| 50 | Ga0160455_100185 | 3300012837 | Bacteria | 59944 |
| 51 | Ga0160445_100417 | 3300012847 | Bacteria | 23081 |
| 52 | Ga0160445_101315 | 3300012847 | Bacteria | 7349 |
| 53 | Ga0466691_008788 | 3300042593 | Eukaryota | 1976 |
| 54 | Ga0466696_010052 | 3300042596 | Bacteria | 2385 |
| 55 | Ga0466701_102988 | 3300042598 | Bacteria | 1383 |
| 56 | Ga0466707_383225 | 3300042601 | Bacteria | 31315 |
| 57 | Ga0466716_152536 | 3300042605 | Bacteria | 3595 |
| 58 | Ga0466719_517355 | 3300042606 | Bacteria | 6718 |
| 59 | Ga0466729_293961 | 3300042621 | Bacteria | 2509 |
| 60 | Ga0466703_409267 | 3300042636 | Bacteria | 4649 |
| 61 | Ga0466704_165666 | 3300042643 | Bacteria | 1850 |
| 62 | Ga0466708_214923 | 3300042652 | Bacteria | 13794 |
| 63 | IMNBGM34_c001111 | 3300000036 | Bacteria | 5238 |
| 64 | JGI24695J34938_10017618 | 3300002450 | Bacteria | 3591 |
| 65 | JGI24695J34938_10058052 | 3300002450 | Bacteria | 1661 |
| 66 | Ga0102740_1003330 | 3300007140 | Bacteria | 4769 |
| 67 | Ga0466733_135775 | 3300042659 | Bacteria | 1712 |
| 68 | Ga0466718_038393 | 3300042617 | Bacteria | 1497 |
| 69 | Ga0466723_130028 | 3300042618 | Bacteria | 7793 |
| 70 | Ga0123353_10000411 | 3300010167 | Bacteria | 52882 |
| 71 | Ga0123353_10204759 | 3300010167 | Bacteria | 3101 |
| 72 | Ga0160440_101969 | 3300012815 | Unclassified | 2315 |
| 73 | Ga0160468_100099 | 3300012819 | Unclassified | 100492 |
| 74 | Ga0160469_101026 | 3300012824 | Bacteria | 8851 |
| 75 | Ga0160472_100651 | 3300012839 | Bacteria | 17700 |
| 76 | Ga0160444_100042 | 3300012841 | Bacteria | 196567 |
| 77 | Ga0160433_100052 | 3300012846 | Bacteria | 131130 |
| 78 | Ga0466696_139793 | 3300042596 | Bacteria | 44856 |
| 79 | Ga0466700_137560 | 3300042600 | Bacteria | 2483 |
| 80 | Ga0466703_097090 | 3300042636 | Bacteria | 8249 |
| 81 | Ga0466703_327547 | 3300042636 | Bacteria | 29461 |
| 82 | Ga0466703_422565 | 3300042636 | Bacteria | 1990 |
| 83 | Ga0466724_34893 | 3300042649 | Bacteria | 121190 |
| 84 | JGI24695J34938_10036190 | 3300002450 | Bacteria | 2252 |
| 85 | Ga0466705_179912 | 3300042612 | Unclassified | 3032 |
| 86 | Ga0466705_257271 | 3300042612 | Bacteria | 7795 |
| 87 | Ga0123356_10198937 | 3300010049 | Bacteria | 2042 |
| 88 | Ga0123353_10006457 | 3300010167 | Bacteria | 15608 |
| 89 | Ga0160458_100140 | 3300012832 | Bacteria | 66872 |
| 90 | Ga0160472_100061 | 3300012839 | Bacteria | 179642 |
| 91 | Ga0160430_104253 | 3300012852 | Bacteria | 3618 |
| 92 | Ga0456237_0008359 | 3300041968 | Eukaryota | 1566 |
| 93 | Ga0466693_048550 | 3300042592 | Bacteria | 2980 |
| 94 | Ga0466695_399584 | 3300042595 | Bacteria | 1972 |
| 95 | Ga0466696_189835 | 3300042596 | Bacteria | 10520 |
| 96 | Ga0466717_140069 | 3300042604 | Bacteria | 3314 |
| 97 | Ga0466719_467372 | 3300042606 | Bacteria | 1825 |
| 98 | Ga0466709_252598 | 3300042648 | Bacteria | 13977 |
| 99 | Ga0466724_51309 | 3300042649 | Bacteria | 6702 |
| 100 | Ga0466708_211985 | 3300042652 | Bacteria | 9147 |
| 101 | Ga0466727_214843 | 3300042655 | Bacteria | 2557 |
| 102 | Ga0104041_1032693 | 3300007106 | Bacteria | 3222 |
| 103 | Ga0104048_1003111 | 3300007143 | Bacteria | 7741 |
| 104 | Ga0466711_271191 | 3300042615 | Bacteria | 5509 |
| 105 | Ga0466723_288655 | 3300042618 | Bacteria | 14153 |
| 106 | Ga0466729_127070 | 3300042621 | Bacteria | 4010 |
| 107 | Ga0123355_10001261 | 3300009826 | Bacteria | 35356 |
| 108 | Ga0123356_10071380 | 3300010049 | Bacteria | 3259 |
| 109 | Ga0123353_10018735 | 3300010167 | Bacteria | 10251 |
| 110 | Ga0123353_10440448 | 3300010167 | Bacteria | 1923 |
| 111 | Ga0160453_101044 | 3300012814 | Bacteria | 12246 |
| 112 | Ga0160446_100015 | 3300012835 | Bacteria | 268940 |
| 113 | Ga0160435_1000046 | 3300012857 | Unclassified | 90992 |
| 114 | Ga0466690_064769 | 3300042590 | Bacteria | 12578 |
| 115 | Ga0466690_097416 | 3300042590 | Bacteria | 1869 |
| 116 | Ga0466701_000344 | 3300042598 | Unclassified | 3624 |
| 117 | Ga0466700_447152 | 3300042600 | Bacteria | 5324 |
| 118 | Ga0466716_037822 | 3300042605 | Bacteria | 19513 |
| 119 | CVPL010W_10001989 | 3300002931 | Unclassified | 24269 |
| 120 | Ga0104050_1003777 | 3300007153 | Bacteria | 5751 |
| 121 | Ga0466715_176814 | 3300042616 | Bacteria | 11551 |
| 122 | Ga0466715_646891 | 3300042616 | Bacteria | 4531 |
| 123 | Ga0466723_158384 | 3300042618 | Bacteria | 7873 |
| 124 | Ga0466726_005761 | 3300042619 | Bacteria | 2837 |
| 125 | Ga0466726_345058 | 3300042619 | Bacteria | 18048 |
| 126 | Ga0123355_10083908 | 3300009826 | Bacteria | 5076 |
| 127 | Ga0123356_10020650 | 3300010049 | Bacteria | 6228 |
| 128 | Ga0123353_10000384 | 3300010167 | Bacteria | 54208 |
| 129 | Ga0160442_100027 | 3300012806 | Bacteria | 268121 |
| 130 | Ga0160433_101315 | 3300012846 | Bacteria | 7182 |
| 131 | Ga0415639_051974 | 3300038395 | Eukaryota | 2263 |
| 132 | Ga0466690_160122 | 3300042590 | Bacteria | 11975 |
| 133 | Ga0466693_237959 | 3300042592 | Unclassified | 1233 |
| 134 | Ga0466699_347869 | 3300042597 | Bacteria | 1716 |
| 135 | Ga0466707_190491 | 3300042601 | Bacteria | 20271 |
| 136 | Ga0466714_136997 | 3300042603 | Bacteria | 5234 |
| 137 | Ga0466734_108586 | 3300042623 | Bacteria | 1918 |
| 138 | Ga0466735_113613 | 3300042624 | Bacteria | 55484 |
| 139 | Ga0466735_159098 | 3300042624 | Bacteria | 5774 |
| 140 | Ga0102734_1000951 | 3300007129 | Bacteria | 9556 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.