Protein Family IF08158
Metagenome
Isolate
141
Members
52
Samples
133
Scaffolds
628.9
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_306490|Ga0466723_306490_2663_4684
- Length
- 673 aa
- Sequence
- MKLEDRFARDTLYTLRSCASHFNRDIKIFVPLQYTFVRLDIFHKILQQYWGYGDFRALQEDIIREVYEGRDVLALMPTGGGKSITFQVPALAKDGICLVITPLIALMKDQVENLKKRDIKALAIHSGMTRKEIDIAFDNAIYGQYKFLYLSPERLGTELFQMRVQKMNVNLLAVDEAHCISQWGYDFRPSYMEIAHARKWLPGVPVLAVTATATPEVARDVMDKLGFRKPNLLQKSFERKNLIYVVREAEDKNTQLLRICNGVPGTGIVYVRSRGNTQEIAAFLNANQISADYYHAGLSAEIRHAKQDDWKQDRTRVMVCTNAFGMGIDKPGVRFVVHVDLPDSIEAYFQEAGRGGRDEKTAYAVLLYNNTDSQKAAQRLRTTFPPVETIREVYQRIYMYFNIPYGAGKGSVFNFSLMDFSVQNKIHSLTAYNALQCLQREGYLELTDELDNPTRVYFTVNRDGLYKVQINNEALDRFIRCLLRAYTGVFTNFVPIDELYLAKLMDVDVAVINDYLLRLSRMRVIDYIPKKRTPLLLFNEERLDEGNLRISKENYGDLKKRYEQRTKAMLHYAANAAQCRSRQLLAYFGETGAASCGRCDVCTGQSAAEVSNYKFNLLSGKIKTLISGNALTLTQCVNSIASNPDDTIKVLRWLIDHDELYETDEGFLQMYDR
Sample Types
Isolate
5.7%
Metagenome
94.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.5%
Kalotermitidae
27.5%
Unclassified
15.7%
Termopsidae
5.9%
Rhinotermitidae
5.9%
Formicidae
5.9%
Passalidae
3.9%
Daphniidae
2.0%
Armadillidiidae
2.0%
Blattidae
2.0%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
137
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 11 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 12 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 13 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 14 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 17 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 18 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 24 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 25 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 26 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 27 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 37 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 38 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 39 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 40 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 43 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 48 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 49 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 50 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 51 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 52 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10133427 | 3300010167 | Bacteria | 3984 |
| 2 | IMNBL1DRAFT_c0000270 | 3300000062 | Bacteria | 45954 |
| 3 | JGI24702J35022_10002908 | 3300002462 | Bacteria | 10367 |
| 4 | JGI24705J35276_12237700 | 3300002504 | Bacteria | 12632 |
| 5 | CVPL010W_10012881 | 3300002931 | Bacteria | 6533 |
| 6 | Ga0466723_042859 | 3300042618 | Bacteria | 12089 |
| 7 | Ga0466713_099770 | 3300042602 | Bacteria | 6289 |
| 8 | Ga0466716_146310 | 3300042605 | Bacteria | 4946 |
| 9 | Ga0466716_302692 | 3300042605 | Bacteria | 5186 |
| 10 | Ga0466716_324965 | 3300042605 | Bacteria | 6347 |
| 11 | Ga0466705_179271 | 3300042612 | Bacteria | 28706 |
| 12 | Ga0466703_098112 | 3300042636 | Bacteria | 4886 |
| 13 | Ga0466708_395512 | 3300042652 | Bacteria | 6294 |
| 14 | Ga0466690_098343 | 3300042590 | Bacteria | 15028 |
| 15 | Ga0466692_051712 | 3300042591 | Bacteria | 14268 |
| 16 | 2227275225 | 2225789004 | Bacteria | 30519 |
| 17 | Ga0466715_014882 | 3300042616 | Bacteria | 29632 |
| 18 | Ga0466715_354554 | 3300042616 | Bacteria | 7039 |
| 19 | Ga0466723_048609 | 3300042618 | Bacteria | 21511 |
| 20 | Ga0466723_253378 | 3300042618 | Bacteria | 5898 |
| 21 | Ga0466726_002951 | 3300042619 | Bacteria | 2019 |
| 22 | Ga0466728_029017 | 3300042620 | Bacteria | 35653 |
| 23 | Ga0466719_342847 | 3300042606 | Bacteria | 9476 |
| 24 | Ga0466703_018269 | 3300042636 | Bacteria | 4281 |
| 25 | Ga0466703_287183 | 3300042636 | Bacteria | 3228 |
| 26 | Ga0466708_187729 | 3300042652 | Bacteria | 24305 |
| 27 | Ga0466690_018591 | 3300042590 | Unclassified | 7559 |
| 28 | Ga0466690_220752 | 3300042590 | Bacteria | 2486 |
| 29 | Ga0466690_250033 | 3300042590 | Bacteria | 18889 |
| 30 | Ga0466690_332832 | 3300042590 | Bacteria | 6459 |
| 31 | Ga0466696_022759 | 3300042596 | Bacteria | 16362 |
| 32 | Ga0466696_089656 | 3300042596 | Bacteria | 11048 |
| 33 | Ga0466696_343675 | 3300042596 | Bacteria | 5082 |
| 34 | Ga0123356_10028754 | 3300010049 | Bacteria | 5209 |
| 35 | Ga0123353_10062711 | 3300010167 | Bacteria | 5962 |
| 36 | Ga0102740_1000263 | 3300007140 | Bacteria | 14961 |
| 37 | Ga0466733_165495 | 3300042659 | Bacteria | 19143 |
| 38 | Ga0466705_453075 | 3300042612 | Bacteria | 5396 |
| 39 | Ga0466711_027006 | 3300042615 | Bacteria | 33406 |
| 40 | Ga0466711_402231 | 3300042615 | Bacteria | 13079 |
| 41 | Ga0466715_004531 | 3300042616 | Bacteria | 37567 |
| 42 | Ga0466715_065073 | 3300042616 | Bacteria | 3462 |
| 43 | Ga0466728_062337 | 3300042620 | Bacteria | 36339 |
| 44 | Ga0466735_102258 | 3300042624 | Bacteria | 10912 |
| 45 | Ga0466703_200042 | 3300042636 | Bacteria | 11528 |
| 46 | Ga0466703_374395 | 3300042636 | Bacteria | 6237 |
| 47 | Ga0466704_357207 | 3300042643 | Unclassified | 3456 |
| 48 | Ga0466709_168950 | 3300042648 | Bacteria | 102495 |
| 49 | Ga0466708_106047 | 3300042652 | Bacteria | 9772 |
| 50 | Ga0466708_365659 | 3300042652 | Bacteria | 7609 |
| 51 | Ga0466690_256695 | 3300042590 | Bacteria | 5054 |
| 52 | Ga0466696_203246 | 3300042596 | Bacteria | 9715 |
| 53 | 2227474637 | 2225789004 | Bacteria | 22737 |
| 54 | IMNBL1DRAFT_c0007408 | 3300000062 | Bacteria | 5775 |
| 55 | IMNBL1DRAFT_c0011803 | 3300000062 | Bacteria | 4052 |
| 56 | IMNBL1DRAFT_c0013817 | 3300000062 | Bacteria | 3596 |
| 57 | Ga0102739_1000052 | 3300007095 | Bacteria | 32705 |
| 58 | Ga0466733_163661 | 3300042659 | Bacteria | 7346 |
| 59 | Ga0466712_053307 | 3300042614 | Bacteria | 4802 |
| 60 | Ga0466711_060441 | 3300042615 | Bacteria | 8538 |
| 61 | Ga0466723_034385 | 3300042618 | Bacteria | 31971 |
| 62 | Ga0466707_134560 | 3300042601 | Bacteria | 9168 |
| 63 | Ga0466713_010077 | 3300042602 | Bacteria | 20113 |
| 64 | Ga0466713_109148 | 3300042602 | Bacteria | 3728 |
| 65 | Ga0466721_150892 | 3300042608 | Bacteria | 16417 |
| 66 | Ga0466697_071249 | 3300042611 | Bacteria | 13729 |
| 67 | Ga0466703_181739 | 3300042636 | Bacteria | 3471 |
| 68 | Ga0466708_121875 | 3300042652 | Bacteria | 12686 |
| 69 | Ga0466690_346489 | 3300042590 | Bacteria | 8459 |
| 70 | Ga0466699_083009 | 3300042597 | Bacteria | 2311 |
| 71 | Ga0123355_10004570 | 3300009826 | Bacteria | 20126 |
| 72 | JGI24698J34947_10043878 | 3300002449 | Unclassified | 2290 |
| 73 | Ga0466705_399901 | 3300042612 | Bacteria | 19786 |
| 74 | Ga0466711_389055 | 3300042615 | Bacteria | 4325 |
| 75 | Ga0466715_232351 | 3300042616 | Bacteria | 13419 |
| 76 | Ga0466723_202456 | 3300042618 | Bacteria | 3827 |
| 77 | Ga0466701_068575 | 3300042598 | Bacteria | 3068 |
| 78 | Ga0466719_048134 | 3300042606 | Bacteria | 8576 |
| 79 | Ga0466703_139806 | 3300042636 | Bacteria | 2348 |
| 80 | Ga0466704_032962 | 3300042643 | Bacteria | 72585 |
| 81 | Ga0466704_127187 | 3300042643 | Bacteria | 3156 |
| 82 | Ga0160455_100038 | 3300012837 | Bacteria | 295540 |
| 83 | Ga0466690_263875 | 3300042590 | Bacteria | 4043 |
| 84 | Ga0466691_028750 | 3300042593 | Bacteria | 5858 |
| 85 | Ga0466696_069715 | 3300042596 | Bacteria | 52641 |
| 86 | Ga0123356_10145953 | 3300010049 | Bacteria | 2341 |
| 87 | Ga0123353_10091573 | 3300010167 | Bacteria | 4898 |
| 88 | Ga0123354_10104514 | 3300010882 | Bacteria | 3798 |
| 89 | JGI24702J35022_10037574 | 3300002462 | Bacteria | 2586 |
| 90 | Ga0072941_1022368 | 3300005201 | Bacteria | 9399 |
| 91 | Ga0466715_352693 | 3300042616 | Bacteria | 4549 |
| 92 | Ga0466723_350295 | 3300042618 | Bacteria | 15700 |
| 93 | Ga0466729_051541 | 3300042621 | Bacteria | 3490 |
| 94 | Ga0466729_057120 | 3300042621 | Bacteria | 37274 |
| 95 | Ga0466716_152236 | 3300042605 | Bacteria | 2952 |
| 96 | Ga0466703_096460 | 3300042636 | Bacteria | 11640 |
| 97 | Ga0466709_267137 | 3300042648 | Bacteria | 107484 |
| 98 | Ga0466709_296916 | 3300042648 | Bacteria | 3536 |
| 99 | Ga0466690_291135 | 3300042590 | Bacteria | 12659 |
| 100 | Ga0466691_179090 | 3300042593 | Bacteria | 9807 |
| 101 | Ga0466696_368802 | 3300042596 | Bacteria | 221772 |
| 102 | Ga0123353_10004979 | 3300010167 | Bacteria | 17306 |
| 103 | Ga0123353_10161174 | 3300010167 | Bacteria | 3571 |
| 104 | Ga0466733_008495 | 3300042659 | Bacteria | 2130 |
| 105 | Ga0466705_470164 | 3300042612 | Bacteria | 5306 |
| 106 | Ga0466711_165561 | 3300042615 | Bacteria | 2433 |
| 107 | Ga0466723_086394 | 3300042618 | Bacteria | 34576 |
| 108 | Ga0466723_092677 | 3300042618 | Bacteria | 22716 |
| 109 | Ga0466723_110924 | 3300042618 | Bacteria | 6068 |
| 110 | Ga0466723_306490 | 3300042618 | Bacteria | 16637 |
| 111 | Ga0466728_011149 | 3300042620 | Bacteria | 7008 |
| 112 | Ga0466728_145377 | 3300042620 | Bacteria | 4792 |
| 113 | Ga0466706_218545 | 3300042599 | Bacteria | 35347 |
| 114 | Ga0466717_038867 | 3300042604 | Bacteria | 2740 |
| 115 | Ga0466729_278721 | 3300042621 | Bacteria | 5566 |
| 116 | Ga0466709_100328 | 3300042648 | Bacteria | 4418 |
| 117 | Ga0466708_341938 | 3300042652 | Bacteria | 4794 |
| 118 | Ga0466727_094701 | 3300042655 | Bacteria | 22527 |
| 119 | Ga0466690_003395 | 3300042590 | Bacteria | 2868 |
| 120 | Ga0466691_088235 | 3300042593 | Bacteria | 2751 |
| 121 | Ga0466733_041516 | 3300042659 | Bacteria | 12765 |
| 122 | Ga0466715_067917 | 3300042616 | Bacteria | 42568 |
| 123 | Ga0466726_170372 | 3300042619 | Bacteria | 8109 |
| 124 | Ga0466716_039770 | 3300042605 | Bacteria | 5468 |
| 125 | Ga0466716_176457 | 3300042605 | Bacteria | 8021 |
| 126 | Ga0466719_196600 | 3300042606 | Bacteria | 3818 |
| 127 | Ga0466722_124683 | 3300042609 | Bacteria | 5503 |
| 128 | Ga0466722_125322 | 3300042609 | Bacteria | 7281 |
| 129 | Ga0466722_182126 | 3300042609 | Bacteria | 7263 |
| 130 | Ga0466703_008449 | 3300042636 | Bacteria | 6025 |
| 131 | Ga0466703_294972 | 3300042636 | Unclassified | 1933 |
| 132 | Ga0466691_107156 | 3300042593 | Bacteria | 9134 |
| 133 | Ga0466691_166354 | 3300042593 | Bacteria | 14141 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.