Protein Family IF07979
Metagenome
Isolate
195
Members
63
Samples
174
Scaffolds
477.78
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_006640|Ga0466723_006640_3046_4707
- Length
- 553 aa
- Sequence
- LYPAHICFFLSLFENAKIHEISQIAHGRIKNVFTKFIEEIYNKKIFETAKNETIKIIYIKDRMKKNLYFCKKLKQNIKAMQKHYFLAFDLGATSGRSILGTLEGDDFEIRELTRFPNTILELHGKYYWDIFGLYKSLKEGLTECAKQGIKLTSTGIDTWGVDFGYTGKDGAILGLPRAYRDPYTAGVSEAFFKIVPREKVYGKTGIQIMDFNSLYQLFAAKNENFSPLNAAEKILFMPDLLSYMLTGKQVCEYTGASTSQILNPETRRFETSLLEAAGIKPSILNTLIDPGTVVGTLTDLLAEETGIGKVPVVAVAGHDTASAVLAVPADNPNFAYLSSGTWSLMGVETEKPVLTKDSFEKNFTNEGGIEGTTRFLKNITGMWLLEQCRKEWEKEGRKYSYAEIVKMAESVAYYKCYINPDDPRLANPASMSKMIASICVENGSQPPATDAEYVRCIFESLVHRYKEVIDMLSEIISFPIEKLHIIGGGSQNELINQMTANQLGIPVIAGPSEATAIGNCMMQAKAAGLVKDRWEIRKIIAKAFAVKTFLPEE
Sample Types
Isolate
10.8%
Metagenome
89.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
24.2%
Kalotermitidae
22.6%
Blattidae
22.6%
Unclassified
11.3%
Rhinotermitidae
6.5%
Termopsidae
4.8%
Hydrophilidae
3.2%
Passalidae
3.2%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
190
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 4 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 7 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 8 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 9 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 17 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 24 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 25 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 26 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 27 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 28 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 36 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 42 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 44 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 51 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 52 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 53 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 54 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 55 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 56 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 57 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 58 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 59 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 60 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 61 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 62 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 63 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_018200 | 3300042600 | Bacteria | 8348 |
| 2 | Ga0466713_027482 | 3300042602 | Bacteria | 12651 |
| 3 | Ga0466717_225618 | 3300042604 | Bacteria | 1833 |
| 4 | Ga0466719_536246 | 3300042606 | Bacteria | 2596 |
| 5 | Ga0466690_292384 | 3300042590 | Bacteria | 9195 |
| 6 | Ga0466691_051621 | 3300042593 | Bacteria | 8516 |
| 7 | Ga0466691_113066 | 3300042593 | Bacteria | 9717 |
| 8 | Ga0466696_237105 | 3300042596 | Bacteria | 19903 |
| 9 | Ga0068305_10178469 | 3300005083 | Unclassified | 1882 |
| 10 | Ga0466729_288296 | 3300042621 | Bacteria | 2105 |
| 11 | Ga0466729_302522 | 3300042621 | Unclassified | 8052 |
| 12 | Ga0466703_242236 | 3300042636 | Bacteria | 5200 |
| 13 | Ga0466723_033742 | 3300042618 | Bacteria | 108590 |
| 14 | Ga0466728_060762 | 3300042620 | Bacteria | 5497 |
| 15 | Ga0466705_102543 | 3300042612 | Bacteria | 3426 |
| 16 | Ga0466705_158665 | 3300042612 | Bacteria | 18276 |
| 17 | Ga0466706_156991 | 3300042599 | Bacteria | 68580 |
| 18 | Ga0466707_391793 | 3300042601 | Bacteria | 4513 |
| 19 | Ga0466713_129978 | 3300042602 | Bacteria | 70140 |
| 20 | Ga0466716_139295 | 3300042605 | Bacteria | 15413 |
| 21 | Ga0466716_165629 | 3300042605 | Bacteria | 14714 |
| 22 | Ga0466719_165306 | 3300042606 | Bacteria | 5365 |
| 23 | Ga0466719_231747 | 3300042606 | Bacteria | 5875 |
| 24 | Ga0466722_210324 | 3300042609 | Bacteria | 22548 |
| 25 | Ga0466656_352580 | 3300042550 | Bacteria | 10661 |
| 26 | Ga0466690_034154 | 3300042590 | Bacteria | 3939 |
| 27 | Ga0466692_183492 | 3300042591 | Bacteria | 12787 |
| 28 | Ga0466691_063953 | 3300042593 | Bacteria | 3502 |
| 29 | Ga0466696_204542 | 3300042596 | Bacteria | 4996 |
| 30 | Ga0466696_312466 | 3300042596 | Bacteria | 5276 |
| 31 | Ga0466696_463796 | 3300042596 | Bacteria | 19807 |
| 32 | JGI24702J35022_10005414 | 3300002462 | Bacteria | 7470 |
| 33 | Ga0068302_10018419 | 3300005071 | Bacteria | 3123 |
| 34 | Ga0466735_103197 | 3300042624 | Bacteria | 1457 |
| 35 | Ga0466703_039989 | 3300042636 | Bacteria | 3622 |
| 36 | Ga0466703_411361 | 3300042636 | Bacteria | 13545 |
| 37 | Ga0466709_013081 | 3300042648 | Bacteria | 23336 |
| 38 | Ga0466725_094720 | 3300042654 | Bacteria | 12438 |
| 39 | Ga0466727_083853 | 3300042655 | Bacteria | 7768 |
| 40 | Ga0466715_017045 | 3300042616 | Bacteria | 22826 |
| 41 | Ga0466715_509459 | 3300042616 | Bacteria | 8884 |
| 42 | Ga0466723_064514 | 3300042618 | Bacteria | 6509 |
| 43 | Ga0466705_120457 | 3300042612 | Unclassified | 3285 |
| 44 | Ga0466733_025776 | 3300042659 | Bacteria | 86348 |
| 45 | Ga0466706_133122 | 3300042599 | Bacteria | 38436 |
| 46 | Ga0466713_032013 | 3300042602 | Bacteria | 64924 |
| 47 | Ga0466719_488972 | 3300042606 | Bacteria | 2335 |
| 48 | Ga0466722_023454 | 3300042609 | Bacteria | 8074 |
| 49 | Ga0466722_265821 | 3300042609 | Bacteria | 7666 |
| 50 | Ga0466693_056569 | 3300042592 | Bacteria | 3799 |
| 51 | Ga0466696_345561 | 3300042596 | Bacteria | 8211 |
| 52 | IMNBL1DRAFT_c0003022 | 3300000062 | Bacteria | 11133 |
| 53 | Ga0068305_10027801 | 3300005083 | Bacteria | 13859 |
| 54 | Ga0072941_1240440 | 3300005201 | Bacteria | 2396 |
| 55 | Ga0466731_315388 | 3300042622 | Bacteria | 1956 |
| 56 | Ga0466704_204223 | 3300042643 | Bacteria | 16498 |
| 57 | Ga0466708_168646 | 3300042652 | Bacteria | 3715 |
| 58 | Ga0466727_130463 | 3300042655 | Bacteria | 6939 |
| 59 | Ga0466727_225007 | 3300042655 | Bacteria | 2686 |
| 60 | Ga0466711_399830 | 3300042615 | Bacteria | 8252 |
| 61 | Ga0466723_032717 | 3300042618 | Bacteria | 15968 |
| 62 | Ga0466729_190457 | 3300042621 | Bacteria | 2678 |
| 63 | Ga0123356_10183353 | 3300010049 | Bacteria | 2117 |
| 64 | Ga0466705_133193 | 3300042612 | Bacteria | 13722 |
| 65 | Ga0466707_250647 | 3300042601 | Bacteria | 6673 |
| 66 | Ga0466713_045837 | 3300042602 | Bacteria | 6488 |
| 67 | Ga0466714_170196 | 3300042603 | Bacteria | 2328 |
| 68 | Ga0466722_096172 | 3300042609 | Bacteria | 28272 |
| 69 | Ga0466722_146298 | 3300042609 | Bacteria | 22965 |
| 70 | Ga0466690_023696 | 3300042590 | Bacteria | 23811 |
| 71 | Ga0466691_017241 | 3300042593 | Bacteria | 7213 |
| 72 | Ga0466696_079205 | 3300042596 | Bacteria | 2810 |
| 73 | Ga0072941_1322877 | 3300005201 | Bacteria | 5525 |
| 74 | Ga0466735_186780 | 3300042624 | Bacteria | 3950 |
| 75 | Ga0466703_015658 | 3300042636 | Bacteria | 18950 |
| 76 | Ga0466703_037385 | 3300042636 | Bacteria | 5044 |
| 77 | Ga0466704_128682 | 3300042643 | Bacteria | 12645 |
| 78 | Ga0466709_062466 | 3300042648 | Bacteria | 7409 |
| 79 | Ga0466725_365748 | 3300042654 | Bacteria | 104297 |
| 80 | Ga0466727_147874 | 3300042655 | Bacteria | 3357 |
| 81 | Ga0466727_234492 | 3300042655 | Bacteria | 5477 |
| 82 | Ga0466711_099584 | 3300042615 | Bacteria | 34400 |
| 83 | Ga0466711_207352 | 3300042615 | Bacteria | 3649 |
| 84 | Ga0466711_325608 | 3300042615 | Bacteria | 13781 |
| 85 | Ga0466711_413937 | 3300042615 | Bacteria | 7952 |
| 86 | Ga0466715_459244 | 3300042616 | Bacteria | 40519 |
| 87 | Ga0466728_088604 | 3300042620 | Bacteria | 32489 |
| 88 | Ga0123353_10003561 | 3300010167 | Bacteria | 19724 |
| 89 | Ga0466705_100268 | 3300042612 | Bacteria | 14782 |
| 90 | Ga0466705_271246 | 3300042612 | Bacteria | 6889 |
| 91 | Ga0466706_014807 | 3300042599 | Bacteria | 31983 |
| 92 | Ga0466707_204250 | 3300042601 | Bacteria | 25895 |
| 93 | Ga0466713_110857 | 3300042602 | Bacteria | 24993 |
| 94 | Ga0466717_298133 | 3300042604 | Bacteria | 1488 |
| 95 | Ga0466690_423985 | 3300042590 | Bacteria | 2879 |
| 96 | Ga0466691_105872 | 3300042593 | Bacteria | 11905 |
| 97 | 2227594072 | 2225789004 | Bacteria | 12803 |
| 98 | Ga0466703_083838 | 3300042636 | Bacteria | 1897 |
| 99 | Ga0466704_086836 | 3300042643 | Bacteria | 9438 |
| 100 | Ga0466708_034593 | 3300042652 | Bacteria | 17359 |
| 101 | Ga0466711_114294 | 3300042615 | Bacteria | 16823 |
| 102 | Ga0466728_357481 | 3300042620 | Bacteria | 21016 |
| 103 | Ga0466729_168096 | 3300042621 | Bacteria | 5802 |
| 104 | Ga0123354_10004445 | 3300010882 | Bacteria | 19882 |
| 105 | Ga0123354_10101598 | 3300010882 | Bacteria | 3882 |
| 106 | Ga0466733_099812 | 3300042659 | Bacteria | 20124 |
| 107 | Ga0466707_135525 | 3300042601 | Bacteria | 5929 |
| 108 | Ga0466713_138099 | 3300042602 | Bacteria | 10720 |
| 109 | Ga0466719_315557 | 3300042606 | Bacteria | 3811 |
| 110 | Ga0466696_115451 | 3300042596 | Bacteria | 1964 |
| 111 | 2227122483 | 2225789004 | Bacteria | 9127 |
| 112 | IMNBL1DRAFT_c0003965 | 3300000062 | Bacteria | 9145 |
| 113 | Ga0068302_10127312 | 3300005071 | Bacteria | 4210 |
| 114 | Ga0466735_217199 | 3300042624 | Bacteria | 2076 |
| 115 | Ga0466703_037252 | 3300042636 | Bacteria | 4334 |
| 116 | Ga0466703_057079 | 3300042636 | Bacteria | 4806 |
| 117 | Ga0466704_063074 | 3300042643 | Bacteria | 10856 |
| 118 | Ga0466704_320799 | 3300042643 | Bacteria | 3242 |
| 119 | Ga0466704_610574 | 3300042643 | Bacteria | 4604 |
| 120 | Ga0466727_196576 | 3300042655 | Bacteria | 91619 |
| 121 | Ga0466711_007932 | 3300042615 | Bacteria | 16347 |
| 122 | Ga0466715_621077 | 3300042616 | Bacteria | 7278 |
| 123 | Ga0466723_110799 | 3300042618 | Bacteria | 7128 |
| 124 | Ga0466733_098937 | 3300042659 | Bacteria | 150442 |
| 125 | Ga0466706_141606 | 3300042599 | Bacteria | 1990 |
| 126 | Ga0466713_048578 | 3300042602 | Unclassified | 2268 |
| 127 | Ga0466713_113316 | 3300042602 | Bacteria | 40093 |
| 128 | Ga0466714_059757 | 3300042603 | Bacteria | 59062 |
| 129 | Ga0466716_167878 | 3300042605 | Bacteria | 9694 |
| 130 | Ga0466719_270811 | 3300042606 | Bacteria | 9663 |
| 131 | Ga0466722_021369 | 3300042609 | Bacteria | 3340 |
| 132 | Ga0466690_040127 | 3300042590 | Bacteria | 2365 |
| 133 | Ga0466692_046708 | 3300042591 | Bacteria | 150257 |
| 134 | Ga0466691_015140 | 3300042593 | Bacteria | 3629 |
| 135 | Ga0466696_124171 | 3300042596 | Bacteria | 8996 |
| 136 | Ga0466696_227581 | 3300042596 | Bacteria | 20008 |
| 137 | Ga0466699_370256 | 3300042597 | Bacteria | 2749 |
| 138 | JGI24702J35022_10002397 | 3300002462 | Bacteria | 11464 |
| 139 | JGI24705J35276_12237825 | 3300002504 | Bacteria | 13403 |
| 140 | JGI24696J40584_12955541 | 3300002834 | Bacteria | 2862 |
| 141 | Ga0466735_234793 | 3300042624 | Bacteria | 3571 |
| 142 | Ga0466704_068446 | 3300042643 | Bacteria | 36408 |
| 143 | Ga0466704_175652 | 3300042643 | Bacteria | 7752 |
| 144 | Ga0466709_072784 | 3300042648 | Bacteria | 4185 |
| 145 | Ga0466727_227555 | 3300042655 | Bacteria | 10119 |
| 146 | Ga0466723_006640 | 3300042618 | Bacteria | 26078 |
| 147 | Ga0466723_333646 | 3300042618 | Bacteria | 9814 |
| 148 | Ga0123354_10038965 | 3300010882 | Bacteria | 7371 |
| 149 | Ga0466733_015565 | 3300042659 | Bacteria | 17314 |
| 150 | Ga0466716_431653 | 3300042605 | Bacteria | 14412 |
| 151 | Ga0466719_240642 | 3300042606 | Bacteria | 11381 |
| 152 | Ga0466722_007565 | 3300042609 | Bacteria | 18233 |
| 153 | Ga0466722_086939 | 3300042609 | Bacteria | 1681 |
| 154 | Ga0466690_104588 | 3300042590 | Bacteria | 10613 |
| 155 | Ga0466690_396645 | 3300042590 | Bacteria | 17447 |
| 156 | Ga0466690_433741 | 3300042590 | Bacteria | 5853 |
| 157 | Ga0466691_205213 | 3300042593 | Bacteria | 17897 |
| 158 | Ga0466696_051573 | 3300042596 | Bacteria | 10685 |
| 159 | Ga0466696_057705 | 3300042596 | Bacteria | 4885 |
| 160 | 2227631843 | 2225789004 | Unclassified | 2118 |
| 161 | JGI24702J35022_10017917 | 3300002462 | Bacteria | 3866 |
| 162 | Ga0068305_10320943 | 3300005083 | Bacteria | 6317 |
| 163 | Ga0466703_301439 | 3300042636 | Bacteria | 12285 |
| 164 | Ga0466704_018563 | 3300042643 | Bacteria | 12561 |
| 165 | Ga0466704_127151 | 3300042643 | Bacteria | 2229 |
| 166 | Ga0466704_289330 | 3300042643 | Bacteria | 13732 |
| 167 | Ga0466708_090904 | 3300042652 | Bacteria | 64814 |
| 168 | Ga0466727_219070 | 3300042655 | Bacteria | 17923 |
| 169 | Ga0466727_238916 | 3300042655 | Bacteria | 16389 |
| 170 | Ga0466711_045786 | 3300042615 | Bacteria | 34187 |
| 171 | Ga0466711_161039 | 3300042615 | Bacteria | 6317 |
| 172 | Ga0466723_277956 | 3300042618 | Bacteria | 20013 |
| 173 | Ga0466728_299084 | 3300042620 | Bacteria | 35234 |
| 174 | Ga0123356_10087362 | 3300010049 | Bacteria | 2962 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.