Protein Family IF07969
Metagenome
Isolate
122
Members
41
Samples
108
Scaffolds
333.84
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_158034|Ga0466718_158034_18503_19603
- Length
- 366 aa
- Sequence
- MSLIILVFAVLIADTKFYCTKFVYICIIIIMKIDMRKWLNNQIAAGVKKTVPALSYSGIQLMDIKVKDIISSSDNQAKGMKLISEKVDSAAVLSLMDMSLEAECFGSEVHFSDSEVPTVVGSIVKNMEDAKKLAVPVIGTGRTLIYIEAVKKACEIIRNKPVLAGTIGPFSLAGRLTGESEAMICCYEEPEMMHTVLSKTAEFLVSYILEYKKIGANGIVIAEPAMGMLSPYLSREFSQPYMRKINDTVRDENFIVIYHNCGNVTVQMIDSILAVNADAYHFGNAIDIVEMMKYIPQNIIVMGSISPSELFHSGTPESIRKATFDLLGKCSKYPNFVISSGCDIPPLSSWKNIEAFFNAVNIYKLN
Sample Types
Isolate
11.5%
Metagenome
88.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.8%
Unclassified
29.3%
Kalotermitidae
12.2%
Passalidae
4.9%
Blattidae
2.4%
Hodotermitidae
2.4%
Taxonomy
Archaea
0
Bacteria
120
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 4 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 5 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 6 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 7 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 8 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 9 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 10 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 17 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 18 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 21 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 22 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 28 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 29 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 30 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 2820462123 | Unclassified Firmicutes Lab288P3bin129 | Isolate | Unclassified |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 38 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 39 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 40 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10001490 | 3300010049 | Bacteria | 25793 |
| 2 | Ga0123356_10035599 | 3300010049 | Bacteria | 4650 |
| 3 | Ga0123356_10103878 | 3300010049 | Bacteria | 2730 |
| 4 | Ga0123356_10705414 | 3300010049 | Bacteria | 1178 |
| 5 | Ga0123353_10384776 | 3300010167 | Bacteria | 2096 |
| 6 | Ga0123353_10845094 | 3300010167 | Bacteria | 1256 |
| 7 | Ga0415639_221222 | 3300038395 | Bacteria | 1210 |
| 8 | Ga0466719_187226 | 3300042606 | Bacteria | 4493 |
| 9 | Ga0466721_115030 | 3300042608 | Unclassified | 3522 |
| 10 | IMNBL1DRAFT_c0002995 | 3300000062 | Bacteria | 11198 |
| 11 | IMNBL1DRAFT_c0006814 | 3300000062 | Bacteria | 6154 |
| 12 | Ga0466728_046233 | 3300042620 | Bacteria | 4489 |
| 13 | Ga0466731_152809 | 3300042622 | Bacteria | 3404 |
| 14 | Ga0123356_10078183 | 3300010049 | Bacteria | 3122 |
| 15 | Ga0123356_10130833 | 3300010049 | Bacteria | 2458 |
| 16 | Ga0123353_10008852 | 3300010167 | Bacteria | 13802 |
| 17 | Ga0123353_10035313 | 3300010167 | Bacteria | 7815 |
| 18 | Ga0123353_10155939 | 3300010167 | Bacteria | 3640 |
| 19 | Ga0123354_10168930 | 3300010882 | Bacteria | 2556 |
| 20 | Ga0466694_005840 | 3300042594 | Bacteria | 106514 |
| 21 | Ga0466714_116463 | 3300042603 | Bacteria | 2130 |
| 22 | Ga0466721_281122 | 3300042608 | Bacteria | 4857 |
| 23 | JGI24696J40584_12948512 | 3300002834 | Bacteria | 2010 |
| 24 | Ga0466725_072732 | 3300042654 | Bacteria | 3318 |
| 25 | Ga0466697_101674 | 3300042611 | Bacteria | 1170 |
| 26 | Ga0466705_194900 | 3300042612 | Bacteria | 1319 |
| 27 | Ga0123356_10002966 | 3300010049 | Bacteria | 17932 |
| 28 | Ga0123356_10016215 | 3300010049 | Bacteria | 7115 |
| 29 | Ga0123356_10017721 | 3300010049 | Bacteria | 6768 |
| 30 | Ga0123356_10084886 | 3300010049 | Bacteria | 3002 |
| 31 | Ga0123356_10677623 | 3300010049 | Bacteria | 1199 |
| 32 | Ga0123353_10000153 | 3300010167 | Bacteria | 86738 |
| 33 | Ga0123353_10108472 | 3300010167 | Bacteria | 4474 |
| 34 | Ga0123353_10329516 | 3300010167 | Bacteria | 2312 |
| 35 | Ga0123353_10369991 | 3300010167 | Bacteria | 2149 |
| 36 | Ga0123354_10240996 | 3300010882 | Bacteria | 1860 |
| 37 | Ga0415639_224545 | 3300038395 | Bacteria | 1376 |
| 38 | Ga0466706_239136 | 3300042599 | Bacteria | 2052 |
| 39 | Ga0466714_060322 | 3300042603 | Bacteria | 17353 |
| 40 | Ga0466698_426282 | 3300042610 | Bacteria | 34482 |
| 41 | Ga0466725_191214 | 3300042654 | Bacteria | 1569 |
| 42 | Ga0466705_292812 | 3300042612 | Bacteria | 10399 |
| 43 | Ga0123355_10440784 | 3300009826 | Bacteria | 1649 |
| 44 | Ga0123355_10543427 | 3300009826 | Bacteria | 1409 |
| 45 | Ga0123356_10078817 | 3300010049 | Bacteria | 3111 |
| 46 | Ga0123356_10108726 | 3300010049 | Bacteria | 2674 |
| 47 | Ga0123356_10126234 | 3300010049 | Bacteria | 2498 |
| 48 | Ga0123353_10049267 | 3300010167 | Bacteria | 6711 |
| 49 | Ga0123353_10054511 | 3300010167 | Bacteria | 6394 |
| 50 | Ga0415639_004422 | 3300038395 | Bacteria | 1902 |
| 51 | Ga0415639_033618 | 3300038395 | Bacteria | 8072 |
| 52 | Ga0466694_390612 | 3300042594 | Bacteria | 1329 |
| 53 | Ga0466717_313131 | 3300042604 | Bacteria | 1502 |
| 54 | Ga0466721_119860 | 3300042608 | Bacteria | 7436 |
| 55 | 2227646816 | 2225789004 | Bacteria | 44589 |
| 56 | JGI24702J35022_10076626 | 3300002462 | Bacteria | 1807 |
| 57 | JGI24705J35276_12220162 | 3300002504 | Bacteria | 2249 |
| 58 | Ga0466703_135325 | 3300042636 | Bacteria | 34761 |
| 59 | Ga0466725_078147 | 3300042654 | Bacteria | 2829 |
| 60 | Ga0466725_217932 | 3300042654 | Bacteria | 1593 |
| 61 | Ga0123357_10241586 | 3300009784 | Bacteria | 1954 |
| 62 | Ga0123356_10000249 | 3300010049 | Bacteria | 61743 |
| 63 | Ga0123356_10000889 | 3300010049 | Bacteria | 33059 |
| 64 | Ga0123356_10017743 | 3300010049 | Bacteria | 6763 |
| 65 | Ga0123356_10055714 | 3300010049 | Bacteria | 3683 |
| 66 | Ga0123356_10092344 | 3300010049 | Bacteria | 2886 |
| 67 | Ga0123353_10201393 | 3300010167 | Bacteria | 3131 |
| 68 | Ga0123353_10267417 | 3300010167 | Unclassified | 2637 |
| 69 | Ga0123353_10432497 | 3300010167 | Bacteria | 1945 |
| 70 | Ga0123353_10734648 | 3300010167 | Bacteria | 1377 |
| 71 | Ga0466719_174794 | 3300042606 | Bacteria | 18623 |
| 72 | 2227588493 | 2225789004 | Bacteria | 13117 |
| 73 | JGI24702J35022_10006972 | 3300002462 | Bacteria | 6496 |
| 74 | Ga0466703_396655 | 3300042636 | Bacteria | 3830 |
| 75 | Ga0123356_10001629 | 3300010049 | Bacteria | 24643 |
| 76 | Ga0123356_10031174 | 3300010049 | Bacteria | 4990 |
| 77 | Ga0123356_10037732 | 3300010049 | Bacteria | 4505 |
| 78 | Ga0123356_10214043 | 3300010049 | Bacteria | 1978 |
| 79 | Ga0123353_10164379 | 3300010167 | Bacteria | 3530 |
| 80 | Ga0415639_089705 | 3300038395 | Bacteria | 1790 |
| 81 | Ga0466718_004551 | 3300042617 | Bacteria | 5520 |
| 82 | Ga0466718_158034 | 3300042617 | Bacteria | 23809 |
| 83 | Ga0466731_015564 | 3300042622 | Bacteria | 8219 |
| 84 | Ga0466731_279854 | 3300042622 | Bacteria | 1592 |
| 85 | Ga0123356_10003393 | 3300010049 | Bacteria | 16705 |
| 86 | Ga0123356_10005423 | 3300010049 | Bacteria | 12980 |
| 87 | Ga0123356_10077670 | 3300010049 | Bacteria | 3132 |
| 88 | Ga0123356_10097447 | 3300010049 | Bacteria | 2814 |
| 89 | Ga0123356_10182832 | 3300010049 | Bacteria | 2120 |
| 90 | Ga0123356_10590267 | 3300010049 | Bacteria | 1275 |
| 91 | Ga0123356_10830128 | 3300010049 | Bacteria | 1095 |
| 92 | Ga0123353_10016188 | 3300010167 | Bacteria | 10886 |
| 93 | Ga0123353_10032287 | 3300010167 | Bacteria | 8128 |
| 94 | Ga0415639_055795 | 3300038395 | Bacteria | 13225 |
| 95 | IMNBL1DRAFT_c0000234 | 3300000062 | Bacteria | 48498 |
| 96 | Ga0123357_10002030 | 3300009784 | Bacteria | 22185 |
| 97 | Ga0466715_157192 | 3300042616 | Bacteria | 8008 |
| 98 | Ga0466733_111961 | 3300042659 | Bacteria | 105531 |
| 99 | Ga0123356_10007874 | 3300010049 | Bacteria | 10608 |
| 100 | Ga0123356_10163964 | 3300010049 | Bacteria | 2224 |
| 101 | Ga0123353_10189793 | 3300010167 | Bacteria | 3245 |
| 102 | Ga0123354_10039383 | 3300010882 | Bacteria | 7326 |
| 103 | Ga0123354_10061245 | 3300010882 | Bacteria | 5556 |
| 104 | Ga0123354_10302182 | 3300010882 | Bacteria | 1511 |
| 105 | Ga0415639_012750 | 3300038395 | Bacteria | 6229 |
| 106 | Ga0466721_400291 | 3300042608 | Bacteria | 8666 |
| 107 | JGI24702J35022_10000965 | 3300002462 | Bacteria | 17962 |
| 108 | Ga0123357_10000486 | 3300009784 | Bacteria | 38493 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01208 | URO-D | Uroporphyrinogen decarboxylase (URO-D) | 66 | 361 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.