Protein Family IF07955
Metagenome
Isolate
170
Members
39
Samples
167
Scaffolds
422.43
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_132083|Ga0466718_132083_853_2139
- Length
- 428 aa
- Sequence
- MSRVHRVRQGDTLGSIAVRYLGSSSKWSKITGANPQLASRRKASDGSPLIYEGDDLIIPEDETASRPTSTYAAAETITLSDAEQDITIKIDGKKYTGFTGYELNLAYDTFDTFSFSAPYSDAMTELQSAIVPFAFKPCDIYYDGVLVFRGTLLTPDPELKDKSGEITLQGYPLCGILNDSMIPPTKYPLECIGINMKGIADAACDPYNIPIVFNGDIGPDFTEVSIEPTEKIMDFLTKLAKQRNLLFSNTEKGELLFFTAKQEKAFASFTEGKTPLLSIKPKFAAQEFYSHITGFTKTDAEYPSYSFTLENKYLIKKGIMRHHSVTIDDAENENDLANSVRAYAGRMFADCVSFELECDGHVNADGERFKKGMGVCVSAPTAMITRETNFIARNVKLVRTAETGKTATLTLILPGSYTGELPEAFPWE
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
37.8%
Termitidae
35.1%
Unclassified
10.8%
Rhinotermitidae
8.1%
Termopsidae
5.4%
Hodotermitidae
2.7%
Taxonomy
Archaea
0
Bacteria
142
Eukaryota
0
Viruses
1
Unclassified
27
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 15 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 36 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 37 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_117886 | 3300024493 | Bacteria | 4901 |
| 2 | Ga0466690_261409 | 3300042590 | Unclassified | 25787 |
| 3 | Ga0466691_059539 | 3300042593 | Bacteria | 8350 |
| 4 | Ga0466691_116543 | 3300042593 | Bacteria | 10189 |
| 5 | Ga0466699_029382 | 3300042597 | Unclassified | 20566 |
| 6 | JGI24695J34938_10008302 | 3300002450 | Bacteria | 5937 |
| 7 | JGI24695J34938_10037345 | 3300002450 | Bacteria | 2208 |
| 8 | Ga0466704_284783 | 3300042643 | Bacteria | 6149 |
| 9 | Ga0466704_533315 | 3300042643 | Unclassified | 18428 |
| 10 | Ga0466709_082881 | 3300042648 | Bacteria | 8763 |
| 11 | Ga0466711_356364 | 3300042615 | Bacteria | 3330 |
| 12 | Ga0466718_169255 | 3300042617 | Bacteria | 2433 |
| 13 | Ga0466723_078764 | 3300042618 | Bacteria | 1591 |
| 14 | Ga0466719_079608 | 3300042606 | Bacteria | 7327 |
| 15 | Ga0466719_186771 | 3300042606 | Bacteria | 13756 |
| 16 | Ga0264413_101707 | 3300024493 | Bacteria | 40945 |
| 17 | Ga0456237_0006606 | 3300041968 | Bacteria | 1811 |
| 18 | Ga0466690_091012 | 3300042590 | Bacteria | 9284 |
| 19 | Ga0466696_096636 | 3300042596 | Bacteria | 3069 |
| 20 | Ga0466696_446511 | 3300042596 | Bacteria | 3595 |
| 21 | AustNasuHG_c1011169 | 3300000089 | Bacteria | 3116 |
| 22 | Ga0072940_1059867 | 3300005200 | Bacteria | 30964 |
| 23 | Ga0072941_1185723 | 3300005201 | Bacteria | 3792 |
| 24 | Ga0466708_132712 | 3300042652 | Bacteria | 50577 |
| 25 | Ga0466708_221172 | 3300042652 | Bacteria | 5045 |
| 26 | Ga0466705_486725 | 3300042612 | Bacteria | 8457 |
| 27 | Ga0466711_332500 | 3300042615 | Bacteria | 2238 |
| 28 | Ga0466718_140102 | 3300042617 | Bacteria | 3491 |
| 29 | Ga0466728_202994 | 3300042620 | Bacteria | 24208 |
| 30 | Ga0466707_174563 | 3300042601 | Bacteria | 4381 |
| 31 | Ga0466719_084040 | 3300042606 | Bacteria | 2774 |
| 32 | Ga0466722_268775 | 3300042609 | Bacteria | 6011 |
| 33 | Ga0466698_285876 | 3300042610 | Unclassified | 8811 |
| 34 | Ga0466705_311918 | 3300042612 | Bacteria | 19807 |
| 35 | Ga0466705_354603 | 3300042612 | Bacteria | 1854 |
| 36 | Ga0466732_218690 | 3300042656 | Bacteria | 2741 |
| 37 | Ga0466696_192480 | 3300042596 | Bacteria | 2994 |
| 38 | Ga0072940_1275449 | 3300005200 | Unclassified | 2049 |
| 39 | Ga0466704_440860 | 3300042643 | Unclassified | 8953 |
| 40 | Ga0466709_008492 | 3300042648 | Bacteria | 4355 |
| 41 | Ga0466705_527041 | 3300042612 | Bacteria | 2374 |
| 42 | Ga0466711_012025 | 3300042615 | Bacteria | 3891 |
| 43 | Ga0466711_028749 | 3300042615 | Bacteria | 4623 |
| 44 | Ga0466711_234597 | 3300042615 | Bacteria | 7835 |
| 45 | Ga0466715_641312 | 3300042616 | Bacteria | 21897 |
| 46 | Ga0466718_084821 | 3300042617 | Bacteria | 6372 |
| 47 | Ga0466723_063839 | 3300042618 | Bacteria | 26761 |
| 48 | Ga0466723_151428 | 3300042618 | Bacteria | 2205 |
| 49 | Ga0466728_019354 | 3300042620 | Bacteria | 9505 |
| 50 | Ga0466728_141380 | 3300042620 | Bacteria | 50120 |
| 51 | Ga0466728_250116 | 3300042620 | Bacteria | 1923 |
| 52 | Ga0466706_266553 | 3300042599 | Bacteria | 4349 |
| 53 | Ga0466716_271347 | 3300042605 | Bacteria | 12315 |
| 54 | Ga0466716_303922 | 3300042605 | Bacteria | 12417 |
| 55 | Ga0466716_314099 | 3300042605 | Bacteria | 10477 |
| 56 | Ga0466719_567852 | 3300042606 | Unclassified | 4053 |
| 57 | Ga0466722_022039 | 3300042609 | Bacteria | 3092 |
| 58 | Ga0123355_10122899 | 3300009826 | Bacteria | 4022 |
| 59 | Ga0466705_290725 | 3300042612 | Unclassified | 9462 |
| 60 | Ga0466690_012697 | 3300042590 | Bacteria | 6358 |
| 61 | AustNasuHG_c1011715 | 3300000089 | Bacteria | 3036 |
| 62 | Ga0072941_1014975 | 3300005201 | Bacteria | 49465 |
| 63 | Ga0466703_274566 | 3300042636 | Bacteria | 7881 |
| 64 | Ga0466704_503131 | 3300042643 | Bacteria | 1968 |
| 65 | Ga0466715_188349 | 3300042616 | Bacteria | 11748 |
| 66 | Ga0466715_275142 | 3300042616 | Bacteria | 4136 |
| 67 | Ga0466718_021512 | 3300042617 | Unclassified | 6276 |
| 68 | Ga0466728_129523 | 3300042620 | Bacteria | 13180 |
| 69 | Ga0466719_532678 | 3300042606 | Bacteria | 6716 |
| 70 | Ga0466722_042537 | 3300042609 | Bacteria | 10639 |
| 71 | Ga0466698_394695 | 3300042610 | Bacteria | 2309 |
| 72 | Ga0466732_324331 | 3300042656 | Bacteria | 3192 |
| 73 | Ga0415639_069646 | 3300038395 | Viruses | 12145 |
| 74 | Ga0456237_0000103 | 3300041968 | Bacteria | 12241 |
| 75 | Ga0456237_0004842 | 3300041968 | Bacteria | 2153 |
| 76 | Ga0466692_171440 | 3300042591 | Bacteria | 3754 |
| 77 | Ga0466694_193466 | 3300042594 | Bacteria | 4929 |
| 78 | Ga0466696_026826 | 3300042596 | Bacteria | 5229 |
| 79 | Ga0466704_183143 | 3300042643 | Bacteria | 6952 |
| 80 | Ga0466704_337816 | 3300042643 | Unclassified | 2483 |
| 81 | Ga0466708_292075 | 3300042652 | Unclassified | 6111 |
| 82 | Ga0466718_132083 | 3300042617 | Bacteria | 3184 |
| 83 | Ga0466723_267259 | 3300042618 | Bacteria | 29909 |
| 84 | Ga0466726_010447 | 3300042619 | Bacteria | 2601 |
| 85 | Ga0466726_160807 | 3300042619 | Bacteria | 10116 |
| 86 | Ga0466726_449194 | 3300042619 | Bacteria | 2025 |
| 87 | Ga0466728_168055 | 3300042620 | Bacteria | 64027 |
| 88 | Ga0466716_075928 | 3300042605 | Bacteria | 5331 |
| 89 | Ga0466719_119307 | 3300042606 | Bacteria | 14561 |
| 90 | Ga0466719_392212 | 3300042606 | Bacteria | 2625 |
| 91 | Ga0466705_120051 | 3300042612 | Unclassified | 6777 |
| 92 | Ga0466705_327183 | 3300042612 | Unclassified | 16362 |
| 93 | Ga0466692_058267 | 3300042591 | Bacteria | 4627 |
| 94 | Ga0466691_094584 | 3300042593 | Bacteria | 5216 |
| 95 | Ga0466696_133802 | 3300042596 | Bacteria | 4214 |
| 96 | JGI24702J35022_10002605 | 3300002462 | Unclassified | 10952 |
| 97 | Ga0072940_1012048 | 3300005200 | Bacteria | 24793 |
| 98 | Ga0466703_009318 | 3300042636 | Bacteria | 5152 |
| 99 | Ga0466703_010036 | 3300042636 | Bacteria | 4664 |
| 100 | Ga0466703_097483 | 3300042636 | Unclassified | 10958 |
| 101 | Ga0466703_222302 | 3300042636 | Bacteria | 19531 |
| 102 | Ga0466704_193633 | 3300042643 | Unclassified | 14904 |
| 103 | Ga0466704_210179 | 3300042643 | Bacteria | 12350 |
| 104 | Ga0466708_107019 | 3300042652 | Unclassified | 9949 |
| 105 | Ga0466712_204165 | 3300042614 | Bacteria | 14830 |
| 106 | Ga0466711_230353 | 3300042615 | Unclassified | 9037 |
| 107 | Ga0466711_348700 | 3300042615 | Bacteria | 2128 |
| 108 | Ga0466715_262929 | 3300042616 | Bacteria | 3699 |
| 109 | Ga0466715_283094 | 3300042616 | Bacteria | 6770 |
| 110 | Ga0466715_644732 | 3300042616 | Bacteria | 7186 |
| 111 | Ga0466718_065146 | 3300042617 | Unclassified | 2588 |
| 112 | Ga0466723_167407 | 3300042618 | Bacteria | 2231 |
| 113 | Ga0466726_108525 | 3300042619 | Bacteria | 2818 |
| 114 | Ga0466726_389945 | 3300042619 | Bacteria | 5122 |
| 115 | Ga0466728_299544 | 3300042620 | Bacteria | 6439 |
| 116 | Ga0466728_452032 | 3300042620 | Bacteria | 10186 |
| 117 | Ga0466716_043240 | 3300042605 | Bacteria | 7638 |
| 118 | Ga0466722_103046 | 3300042609 | Bacteria | 13207 |
| 119 | Ga0466705_167626 | 3300042612 | Bacteria | 2042 |
| 120 | Ga0466690_110502 | 3300042590 | Bacteria | 1466 |
| 121 | Ga0466691_113332 | 3300042593 | Bacteria | 5440 |
| 122 | Ga0466696_001322 | 3300042596 | Bacteria | 2955 |
| 123 | Ga0466696_051762 | 3300042596 | Bacteria | 12884 |
| 124 | Ga0466696_385739 | 3300042596 | Bacteria | 1438 |
| 125 | Ga0072940_1012626 | 3300005200 | Bacteria | 28398 |
| 126 | Ga0072940_1186870 | 3300005200 | Bacteria | 7055 |
| 127 | Ga0072941_1079071 | 3300005201 | Bacteria | 20382 |
| 128 | Ga0466703_060807 | 3300042636 | Bacteria | 4088 |
| 129 | Ga0466703_330549 | 3300042636 | Bacteria | 15514 |
| 130 | Ga0466704_134553 | 3300042643 | Unclassified | 11700 |
| 131 | Ga0466704_139675 | 3300042643 | Bacteria | 13760 |
| 132 | Ga0466704_189146 | 3300042643 | Bacteria | 7115 |
| 133 | Ga0466709_018804 | 3300042648 | Bacteria | 36444 |
| 134 | Ga0466709_127531 | 3300042648 | Bacteria | 9396 |
| 135 | Ga0466709_162353 | 3300042648 | Bacteria | 5445 |
| 136 | Ga0466708_449140 | 3300042652 | Bacteria | 9657 |
| 137 | Ga0466712_282875 | 3300042614 | Bacteria | 3723 |
| 138 | Ga0466723_198410 | 3300042618 | Bacteria | 14980 |
| 139 | Ga0466723_210129 | 3300042618 | Bacteria | 13635 |
| 140 | Ga0466728_284256 | 3300042620 | Bacteria | 3180 |
| 141 | Ga0466705_322187 | 3300042612 | Unclassified | 5420 |
| 142 | Ga0466705_380047 | 3300042612 | Bacteria | 10437 |
| 143 | Ga0264413_118026 | 3300024493 | Bacteria | 23484 |
| 144 | Ga0466690_050768 | 3300042590 | Bacteria | 1773 |
| 145 | Ga0466690_227825 | 3300042590 | Bacteria | 7798 |
| 146 | Ga0466692_127566 | 3300042591 | Bacteria | 11633 |
| 147 | Ga0466692_134132 | 3300042591 | Unclassified | 28684 |
| 148 | Ga0466692_177425 | 3300042591 | Unclassified | 1887 |
| 149 | Ga0466691_116861 | 3300042593 | Bacteria | 5257 |
| 150 | Ga0466691_139690 | 3300042593 | Bacteria | 13116 |
| 151 | Ga0466691_140763 | 3300042593 | Bacteria | 5634 |
| 152 | Ga0466691_169982 | 3300042593 | Bacteria | 6637 |
| 153 | Ga0466695_204050 | 3300042595 | Bacteria | 2491 |
| 154 | Ga0466696_113707 | 3300042596 | Unclassified | 3880 |
| 155 | Ga0466703_074514 | 3300042636 | Bacteria | 2161 |
| 156 | Ga0466703_236030 | 3300042636 | Bacteria | 4820 |
| 157 | Ga0466704_104708 | 3300042643 | Bacteria | 12340 |
| 158 | Ga0466709_192166 | 3300042648 | Unclassified | 4223 |
| 159 | Ga0466709_199079 | 3300042648 | Unclassified | 4218 |
| 160 | Ga0466708_059398 | 3300042652 | Bacteria | 16683 |
| 161 | Ga0466708_260954 | 3300042652 | Bacteria | 2751 |
| 162 | Ga0466727_088868 | 3300042655 | Unclassified | 13674 |
| 163 | Ga0466711_449184 | 3300042615 | Bacteria | 1364 |
| 164 | Ga0466718_075886 | 3300042617 | Bacteria | 44936 |
| 165 | Ga0466723_203940 | 3300042618 | Bacteria | 7691 |
| 166 | Ga0466728_368898 | 3300042620 | Bacteria | 2807 |
| 167 | Ga0466716_144424 | 3300042605 | Bacteria | 1935 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF22255 | Gp44-like_2nd | Baseplate hub protein gp44-like, second domain | 174 | 257 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.