Protein Family IF07947

Metagenome Isolate
265 Members
183 Samples
152 Scaffolds
415.85 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_124131|Ga0466718_124131_254_1645
Length
463 aa
Sequence
MCGDAYVALCLKTALTRAGNNGKILVLTFLSNPACSGHGITGNGKDFTMRRVAITGMGVVSPIGIGIQTFWQSIKEGVSGIAPITRFDASTLACRIAGEVKNYKAVDFLDHRLVQRTALFTQFAMIASQEAWNDAGLNRFTFDDPSRCGVLLGNGIGGLEVDDEAHRKLFDKGSSRIPAMTIPKMIANEAAGNVSMMLGIKGSAHVVVTACASGTDAIGFALDRIRFGRADVVLTGGAESTITEYGIGGFCQLKALSTDFNDTPHRASRPFDKNRDGFVMGEGAGILVLEEWEHAKRRGAAIYAELAGFGASADAFHLTAPSPDGEGAARAIRLALQDAGLQLEQVDYINAHGTSTPINDPIETKAIKIAFGEHAYKLAVSSTKSMTGHALGAAGGMETIITVLAIREGVFPTTLNLDEPDPECDLDYVPNKGRRGAIESALSLSLGFGGHNSVIAVKKHTER

📊 Sample Types

Isolate 42.6%
Metagenome 57.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 17.1%
Drosophilidae 14.7%
Termitidae 13.5%
Anthocoridae 8.2%
Kalotermitidae 7.6%
Elmidae 6.5%
Curculionidae 6.5%
Apidae 6.5%
Culicidae 4.1%
Armadillidiidae 3.5%
Tenebrionidae 1.8%
Stratiomyidae 1.2%
Rhinotermitidae 1.2%
Hydrophilidae 1.2%
Tephritidae 1.2%
Formicidae 1.2%
Pentatomidae 0.6%
Noctuidae 0.6%
Termopsidae 0.6%
Crambidae 0.6%
Ceratopogonidae 0.6%
Calliphoridae 0.6%
Passalidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 252
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
2 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
3 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
4 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
5 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
6 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
7 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
8 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
9 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
10 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
11 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
12 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
13 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
14 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
15 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
16 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
17 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
18 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
19 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
20 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
21 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
22 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
23 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
24 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
25 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
26 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
27 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
28 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
29 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
30 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
31 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
32 648276708 Pantoea sp. aB Isolate Unclassified
33 8017489919 Lactobacillus brevis EF Isolate Unclassified
34 8100455565 Delftia sp. S67 Isolate Curculionidae
35 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
36 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
37 3004719924 Lactobacillus sp. W8174 Isolate Apidae
38 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
39 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
40 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
41 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
42 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
43 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
44 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
45 2820180635 Unclassified Planctomycetes Lab288P3bin24 Isolate Unclassified
46 8021546568 Klebsiella sp. Kps Isolate Tephritidae
47 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
48 8103002986 Erwinia sp. S38 Isolate Curculionidae
49 8103008710 Erwinia sp. S43 Isolate Curculionidae
50 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
51 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
52 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
53 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
54 3300007058 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut Metagenome Drosophilidae
55 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
56 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
57 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
58 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
59 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
60 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
61 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
62 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
63 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
64 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
65 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
66 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
67 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
68 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
69 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
70 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
71 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
72 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
73 8100461708 Delftia sp. S65 Isolate Curculionidae
74 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
75 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
76 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
77 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
78 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
79 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
80 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
81 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
82 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
83 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
84 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
85 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
86 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
87 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
88 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
89 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
90 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
91 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
92 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
93 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
94 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
95 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
96 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
97 2864993140 Agrobacterium vitis S00303 Isolate Elmidae
98 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
99 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
100 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
101 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
102 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
103 8116947750 Gluconacetobacter sacchari DSM 12717 Isolate Unclassified
104 2820646798 Unclassified Firmicutes Cu122P5bin36 Isolate Unclassified
105 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
106 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
107 8100449422 Delftia sp. S66 Isolate Curculionidae
108 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
109 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
110 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
111 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
112 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
113 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
114 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
115 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
116 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
117 2873468275 Agrobacterium vitis S00131 Isolate Elmidae
118 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
119 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
120 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
121 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
122 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
123 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
124 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
125 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
126 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
127 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
128 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
129 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
130 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
131 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
132 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
133 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
134 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
135 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
136 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
137 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
138 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
139 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
140 3300005313 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 2 gut Metagenome Drosophilidae
141 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
142 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
143 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
144 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
145 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
146 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
147 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
148 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
149 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
150 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
151 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
152 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
153 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
154 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
155 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
156 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified
157 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
158 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
159 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
160 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
161 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
162 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
163 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
164 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
165 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
166 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
167 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
168 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
169 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
170 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
171 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
172 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
173 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
174 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
175 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
176 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
177 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
178 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
179 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
180 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
181 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
182 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
183 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_342741 3300042612 Bacteria 3453
2 Ga0530661_002469 3300056564 Bacteria 6917
3 JGI24696J40584_12953012 3300002834 Bacteria 2420
4 Ga0104043_1013564 3300007058 Unclassified 2732
5 Ga0104048_1000346 3300007143 Bacteria 1905
6 Ga0466715_256397 3300042616 Bacteria 48192
7 Ga0466715_450713 3300042616 Bacteria 2156
8 Ga0466723_007722 3300042618 Bacteria 5770
9 Ga0160445_100205 3300012847 Bacteria 45031
10 Ga0160443_101420 3300012848 Bacteria 8148
11 Ga0264413_113114 3300024493 Bacteria 29034
12 Ga0265387_1000010 3300024582 Bacteria 82223
13 Ga0466690_213691 3300042590 Bacteria 4139
14 Ga0466724_38768 3300042649 Bacteria 155416
15 Ga0466708_111955 3300042652 Bacteria 8192
16 Ga0466701_072274 3300042598 Bacteria 8508
17 Ga0466717_010075 3300042604 Bacteria 4736
18 Ga0466717_196976 3300042604 Bacteria 1457
19 Ga0466717_206648 3300042604 Bacteria 6043
20 Ga0160430_100367 3300012852 Bacteria 28500
21 Ga0466692_044271 3300042591 Bacteria 1330
22 Ga0466692_087582 3300042591 Bacteria 8392
23 Ga0466696_122289 3300042596 Bacteria 1518
24 Ga0466730_088042 3300042625 Bacteria 113057
25 Ga0466707_036687 3300042601 Bacteria 3753
26 Ga0466707_100121 3300042601 Bacteria 9536
27 Ga0466707_208962 3300042601 Bacteria 5886
28 Ga0466717_164695 3300042604 Bacteria 2428
29 Ga0466719_558184 3300042606 Bacteria 12938
30 Ga0123355_10001500 3300009826 Bacteria 32526
31 Ga0123356_10002820 3300010049 Bacteria 18388
32 Ga0123356_10026804 3300010049 Bacteria 5407
33 Ga0123356_10049704 3300010049 Bacteria 3903
34 Ga0123353_10001038 3300010167 Bacteria 34037
35 Ga0123353_10038567 3300010167 Bacteria 7508
36 Ga0123353_10270572 3300010167 Bacteria 2618
37 Ga0123353_10405231 3300010167 Bacteria 2028
38 DPO_contig03231 2032320009 Bacteria 15995
39 IMNBGM34_c003576 3300000036 Bacteria 2136
40 JGI24698J34947_10030981 3300002449 Bacteria 2818
41 JGI24702J35022_10085822 3300002462 Bacteria 1709
42 Ga0466723_104311 3300042618 Bacteria 4382
43 Ga0466726_232158 3300042619 Bacteria 18939
44 Ga0160453_100040 3300012814 Bacteria 158320
45 Ga0160447_101243 3300012849 Bacteria 10145
46 Ga0160435_1000236 3300012857 Bacteria 26109
47 Ga0466695_230536 3300042595 Bacteria 1425
48 Ga0466701_005097 3300042598 Unclassified 6611
49 Ga0466729_225766 3300042621 Bacteria 2797
50 Ga0466704_108183 3300042643 Bacteria 4013
51 Ga0466701_074521 3300042598 Bacteria 7966
52 Ga0466701_097318 3300042598 Unclassified 15964
53 Ga0466719_102272 3300042606 Bacteria 3806
54 Ga0123357_10053152 3300009784 Bacteria 5467
55 Ga0123355_10002038 3300009826 Bacteria 28565
56 Ga0123356_10167858 3300010049 Bacteria 2201
57 Ga0123353_10004784 3300010167 Bacteria 17567
58 Ga0123353_10027972 3300010167 Bacteria 8650
59 Ga0466732_007696 3300042656 Bacteria 4977
60 DPOL_contig03341 2035918003 Bacteria 32526
61 DPOL_contig20255 2035918003 Bacteria 9889
62 Ga0466712_175032 3300042614 Bacteria 1631
63 Ga0466711_332676 3300042615 Bacteria 1873
64 Ga0466718_124131 3300042617 Bacteria 2031
65 Ga0160467_101117 3300012829 Bacteria 13587
66 Ga0160446_100042 3300012835 Bacteria 136934
67 Ga0160472_100308 3300012839 Unclassified 49704
68 Ga0160444_100078 3300012841 Bacteria 129686
69 Ga0264413_122045 3300024493 Unclassified 3105
70 Ga0466691_065155 3300042593 Bacteria 1778
71 Ga0466695_404296 3300042595 Bacteria 4054
72 Ga0466703_053637 3300042636 Bacteria 2336
73 Ga0466724_30026 3300042649 Bacteria 308356
74 Ga0466701_037076 3300042598 Bacteria 58845
75 Ga0466717_211343 3300042604 Bacteria 1613
76 Ga0466720_012040 3300042607 Bacteria 5674
77 Ga0123353_10195134 3300010167 Bacteria 3192
78 Ga0466705_075410 3300042612 Bacteria 4094
79 SPBB_contig00051 2044078006 Bacteria 162835
80 FGTW_contig30602 2065487013 Bacteria 14608
81 Ga0466726_002227 3300042619 Bacteria 4702
82 Ga0466693_414891 3300042592 Unclassified 3013
83 Ga0466694_246003 3300042594 Bacteria 6807
84 Ga0466695_113470 3300042595 Bacteria 1628
85 Ga0466696_150596 3300042596 Bacteria 5063
86 Ga0466704_233296 3300042643 Bacteria 10870
87 Ga0466724_14896 3300042649 Bacteria 6505
88 Ga0466701_062563 3300042598 Bacteria 172647
89 Ga0466720_111065 3300042607 Bacteria 1658
90 Ga0123355_10063957 3300009826 Bacteria 5932
91 Ga0123353_10003862 3300010167 Unclassified 19126
92 Ga0123353_10397690 3300010167 Bacteria 2052
93 Ga0160454_100236 3300012798 Unclassified 54671
94 Ga0466705_123481 3300042612 Unclassified 3223
95 Ga0562379_0779 3300056790 Bacteria 51756
96 SPBB_contig01538 2044078006 Bacteria 29469
97 JGI24695J34938_10008195 3300002450 Bacteria 5995
98 Ga0074278_132307 3300005721 Bacteria 8545
99 Ga0466723_275891 3300042618 Bacteria 1651
100 Ga0466726_164278 3300042619 Bacteria 16045
101 Ga0160452_100276 3300012834 Bacteria 48547
102 Ga0160433_100010 3300012846 Bacteria 293456
103 Ga0466695_249848 3300042595 Bacteria 2476
104 Ga0466696_188110 3300042596 Bacteria 15668
105 Ga0466696_245121 3300042596 Bacteria 4906
106 Ga0466704_420691 3300042643 Bacteria 6599
107 Ga0466708_048981 3300042652 Bacteria 29674
108 Ga0466708_105411 3300042652 Bacteria 7077
109 Ga0466701_017732 3300042598 Bacteria 17330
110 Ga0466701_046154 3300042598 Bacteria 3065
111 Ga0466717_093847 3300042604 Bacteria 11973
112 Ga0466719_241567 3300042606 Bacteria 4741
113 Ga0123356_10037223 3300010049 Bacteria 4541
114 DPO_contig06799 2032320009 Unclassified 41801
115 CVPL010L_1000170 3300002932 Bacteria 42285
116 Ga0072940_1336870 3300005200 Bacteria 1489
117 Ga0074307_1000017 3300005313 Bacteria 1803
118 Ga0466711_048781 3300042615 Bacteria 12260
119 Ga0466715_467100 3300042616 Bacteria 2201
120 Ga0466729_012680 3300042621 Bacteria 4655
121 Ga0466729_118811 3300042621 Bacteria 2658
122 Ga0160469_100140 3300012824 Bacteria 86677
123 Ga0160467_100761 3300012829 Bacteria 22656
124 Ga0466699_279466 3300042597 Bacteria 4867
125 Ga0466729_318198 3300042621 Bacteria 4910
126 Ga0466730_076511 3300042625 Bacteria 5491
127 Ga0466725_331584 3300042654 Bacteria 11430
128 Ga0466716_182446 3300042605 Bacteria 2344
129 Ga0123357_10014061 3300009784 Bacteria 10429
130 Ga0123353_10011784 3300010167 Bacteria 12349
131 Ga0160466_100155 3300012809 Bacteria 54691
132 Ga0466705_082072 3300042612 Bacteria 49126
133 JGI24695J34938_10014075 3300002450 Bacteria 4166
134 Meta3P_1004596 3300002464 Unclassified 8331
135 Ga0466705_408122 3300042612 Bacteria 3349
136 Ga0466715_258969 3300042616 Bacteria 4306
137 Ga0466723_046115 3300042618 Bacteria 5327
138 Ga0466723_239264 3300042618 Bacteria 3003
139 Ga0466728_031064 3300042620 Bacteria 13389
140 Ga0466729_149901 3300042621 Bacteria 11675
141 Ga0160443_100087 3300012848 Bacteria 160827
142 Ga0466690_330778 3300042590 Unclassified 4571
143 Ga0466693_077039 3300042592 Bacteria 3645
144 Ga0466731_377378 3300042622 Bacteria 1937
145 Ga0466703_135325 3300042636 Bacteria 34761
146 Ga0466703_275317 3300042636 Bacteria 6750
147 Ga0466724_34031 3300042649 Unclassified 1319
148 Ga0466708_240845 3300042652 Bacteria 1240
149 Ga0466719_140757 3300042606 Bacteria 7816
150 Ga0123356_10000059 3300010049 Bacteria 117133
151 Ga0123356_10006941 3300010049 Bacteria 11371
152 Ga0123353_10451325 3300010167 Bacteria 1893

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 303 417 0.98
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 49 294 0.9
PF00108 Thiolase_N Thiolase, N-terminal domain 192 240 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00108 GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.