Protein Family IF07936

Metagenome Isolate
362 Members
212 Samples
224 Scaffolds
243.11 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_104812|Ga0466718_104812_1117_1956
Length
279 aa
Sequence
MHDDAAAARRNSTPGSGASARGHASFPPGSDDDVLHASAPGDGSKPRRVLLKLSGEAFGGGQMGVDAYVVRRIAEEIAVAVKQGVQVAVVVGGGNYFRGADLAQAGMQRERADYMGMLGTVMNCLSLQDFLEKDGVATRVQTAIAMGQVAEPYIPLRAIRHLEKGRVVIFGAGAGLPYFSTDTVAIQRALEIGCDEVLMGKNGVDGVYDADPNKVSGATKFDHLTFDEALERKLAVMDSTAMAMARDNGVHMRVFGLEGYGNVTKSLLGEKIGTEVTPN

πŸ“Š Sample Types

Isolate 38.1%
Metagenome 61.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 34.5%
Termitidae 14.0%
Apidae 9.0%
Kalotermitidae 6.0%
Anthocoridae 5.0%
Culicidae 5.0%
Cambaridae 4.5%
Tenebrionidae 3.5%
Scarabaeidae 3.0%
Armadillidiidae 2.0%
Formicidae 2.0%
Hydrophilidae 2.0%
Dytiscidae 2.0%
Rhinotermitidae 1.5%
Curculionidae 1.0%
Termopsidae 1.0%
Chironomidae 0.5%
Ixodidae 0.5%
Siricidae 0.5%
Passalidae 0.5%
Pentatomidae 0.5%
Pyralidae 0.5%
Hodotermitidae 0.5%
Cerambycidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 341
Eukaryota 0
Viruses 0
Unclassified 21

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
2 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
3 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
4 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
5 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
6 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
7 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
8 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
9 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
10 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
11 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
12 2862784999 Streptomyces sp. M41 Isolate Unclassified
13 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
14 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
15 2909412500 Yimella sp. cx-573 Isolate Cambaridae
16 2931425734 Nocardioides sp. J2M5 Isolate
17 2931430189 Tessaracoccus palaemonis J1M15 Isolate
18 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
19 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
20 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
21 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
22 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
23 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
24 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
25 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
26 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
27 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
32 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
33 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
34 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
35 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
36 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
37 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
38 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
39 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
40 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
41 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
42 2663763384 Bifidobacterium bombi DSM 19703 Isolate Apidae
43 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
44 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
45 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
46 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
47 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
48 2865983822 Bifidobacterium xylocopae XV2 Isolate Apidae
49 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
50 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
51 2896955351 Streptomyces sp. GF20 Isolate Termitidae
52 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
53 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
54 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
55 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
56 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
57 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
58 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
59 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
60 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
61 8062637095 Yimella sp. cx-51 Isolate Cambaridae
62 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
63 2505679068 Isoptericola variabilis 225 Isolate Unclassified
64 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
65 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
66 2820807258 Unclassified Actinobacteria Nt197P3bin90 Isolate Unclassified
67 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
68 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
69 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
70 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
71 2820922474 Unclassified Actinobacteria Emb289P3bin154 Isolate Unclassified
72 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
73 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
74 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
75 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
76 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
77 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
78 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
79 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
80 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
81 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
82 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
83 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
84 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
85 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
86 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
87 2568526170 Bifidobacterium sp. A11 Isolate Apidae
88 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
89 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
90 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
91 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
92 2820834831 Unclassified Actinobacteria Lab288P4bin79 Isolate Unclassified
93 2820840446 Unclassified Actinobacteria Lab288P4bin17 Isolate Unclassified
94 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
95 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
96 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
97 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
98 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
99 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
100 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
101 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
102 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
103 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
104 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
105 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
106 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
107 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
108 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
109 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
110 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
111 2065487017 Actinobacterium Actino7 (unscreened) Isolate Unclassified
112 8062747827 Yimella sp. cx-51 Isolate Cambaridae
113 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
114 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
115 2802429577 Bifidobacterium indicum DSM 20214 Isolate Unclassified
116 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
117 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
118 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
119 2820903739 Unclassified Actinobacteria Emb289P4bin49 Isolate Unclassified
120 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
121 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
122 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
123 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
124 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
125 2912749649 Streptomyces sp. GS7 Isolate Termitidae
126 3006461590 Streptomyces sp. RB5 Isolate Termitidae
127 3006667155 Streptomyces sp. SID9727 Isolate
128 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
129 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
130 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
131 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
132 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
133 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
134 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
135 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
136 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
137 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
138 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
139 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
140 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
141 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
142 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
143 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
144 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
145 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
146 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
147 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
148 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
149 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
150 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
151 2908241010 Streptomyces sp. HF10 Isolate Termitidae
152 2912817845 Streptomyces griseus SID164 Isolate
153 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
154 3006468911 Streptomyces sp. RB17 Isolate Termitidae
155 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
156 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
157 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
158 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
159 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
160 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
161 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
162 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
163 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
164 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
165 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
166 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
167 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
168 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
169 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
170 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
171 2504756063 Isoptericola variabilis J5 Isolate Unclassified
172 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
173 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
174 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
175 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
176 2820816657 Unclassified Actinobacteria Nt197P3bin38 Isolate Unclassified
177 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
178 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
179 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
180 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
181 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
182 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
183 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
184 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
185 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
186 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
187 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
188 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
189 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
190 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
191 2547132081 Streptomyces sp. S4 Isolate Formicidae
192 2660238275 Bifidobacterium indicum DSM 20214 Isolate Unclassified
193 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
194 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
195 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
196 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
197 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
198 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
199 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
200 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
201 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
202 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
203 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
204 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
205 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
206 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
207 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
208 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
209 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
210 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
211 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
212 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_087265 3300042659 Bacteria 208960
2 Ga0562378_0051 3300056814 Bacteria 353762
3 Ga0466706_219179 3300042599 Bacteria 2053
4 Ga0466707_293698 3300042601 Unclassified 5019
5 Ga0466713_156644 3300042602 Bacteria 21718
6 Ga0123357_10044902 3300009784 Bacteria 5997
7 Ga0123357_10236827 3300009784 Bacteria 1986
8 Ga0123357_10522062 3300009784 Bacteria 969
9 Ga0123355_10565355 3300009826 Bacteria 1367
10 Ga0123356_10011427 3300010049 Bacteria 8655
11 Ga0123356_10399299 3300010049 Bacteria 1512
12 Ga0123356_10829441 3300010049 Bacteria 1096
13 Ga0123353_10004539 3300010167 Bacteria 17893
14 Ga0123353_10277489 3300010167 Bacteria 2577
15 Ga0123354_10235693 3300010882 Bacteria 1899
16 JGI24705J35276_12172389 3300002504 Bacteria 1303
17 JGI24705J35276_12228570 3300002504 Bacteria 3210
18 JGI24699J35502_11133956 3300002509 Bacteria 21193
19 Ga0072940_1069746 3300005200 Bacteria 17264
20 Ga0072941_1356427 3300005201 Bacteria 1408
21 Ga0123357_10001404 3300009784 Bacteria 25509
22 Ga0466718_038545 3300042617 Bacteria 12057
23 Ga0466723_168678 3300042618 Bacteria 2975
24 Ga0466723_235819 3300042618 Bacteria 8013
25 Ga0466728_355614 3300042620 Bacteria 1807
26 Ga0466705_055335 3300042612 Bacteria 2044
27 Ga0466704_312945 3300042643 Bacteria 75035
28 Ga0466704_599028 3300042643 Bacteria 5940
29 Ga0160460_102857 3300012845 Unclassified 3481
30 Ga0160447_100799 3300012849 Bacteria 13531
31 Ga0160434_100775 3300012850 Unclassified 7192
32 Ga0562379_0016 3300056790 Bacteria 1192610
33 Ga0562376_0079 3300056857 Bacteria 227259
34 Ga0562374_0551 3300057007 Bacteria 60750
35 Ga0123357_10024387 3300009784 Bacteria 8142
36 Ga0123357_10243953 3300009784 Bacteria 1939
37 Ga0123356_10000150 3300010049 Bacteria 78432
38 Ga0123356_10005036 3300010049 Bacteria 13539
39 Ga0123356_10009253 3300010049 Bacteria 9733
40 Ga0123354_10002262 3300010882 Bacteria 25152
41 AustNasuHG_c1000174 3300000089 Bacteria 20828
42 JGI24699J35502_11132553 3300002509 Bacteria 7077
43 Ga0123357_10000214 3300009784 Bacteria 54542
44 Ga0466705_490321 3300042612 Unclassified 1494
45 Ga0466710_241925 3300042613 Bacteria 2037
46 Ga0466723_108690 3300042618 Bacteria 2848
47 Ga0466705_324004 3300042612 Bacteria 1408
48 Ga0466729_254167 3300042621 Bacteria 1788
49 Ga0466734_128942 3300042623 Bacteria 1713
50 Ga0466703_225395 3300042636 Bacteria 58668
51 Ga0466703_418179 3300042636 Unclassified 2811
52 Ga0160458_100016 3300012832 Bacteria 326466
53 Ga0160446_100089 3300012835 Unclassified 86986
54 Ga0466696_163402 3300042596 Bacteria 3031
55 Ga0466696_461538 3300042596 Bacteria 3138
56 Ga0562379_0115 3300056790 Unclassified 253623
57 Ga0562379_0375 3300056790 Bacteria 102463
58 Ga0562375_0311 3300056856 Bacteria 119686
59 Ga0466713_111704 3300042602 Bacteria 1241
60 Ga0466713_122468 3300042602 Bacteria 4518
61 Ga0466719_138891 3300042606 Bacteria 99480
62 Ga0123356_10022293 3300010049 Unclassified 5981
63 Ga0123356_10029100 3300010049 Bacteria 5174
64 Ga0123354_10000030 3300010882 Bacteria 106941
65 Ga0123354_10088571 3300010882 Bacteria 4304
66 Ga0102734_1000022 3300007129 Bacteria 50061
67 Ga0466718_104812 3300042617 Bacteria 3663
68 Ga0466728_138990 3300042620 Bacteria 17577
69 Ga0466728_336806 3300042620 Bacteria 16466
70 Ga0466705_058081 3300042612 Bacteria 3765
71 Ga0466705_091340 3300042612 Bacteria 15065
72 Ga0466703_033530 3300042636 Bacteria 14410
73 Ga0160453_104730 3300012814 Bacteria 2407
74 Ga0160441_100619 3300012825 Bacteria 22203
75 Ga0160431_101341 3300012828 Bacteria 7207
76 Ga0160452_100032 3300012834 Bacteria 218733
77 Ga0160443_100006 3300012848 Bacteria 647325
78 Ga0466696_057045 3300042596 Bacteria 1417
79 Ga0466696_247362 3300042596 Bacteria 5100
80 Ga0466696_506409 3300042596 Bacteria 4184
81 Ga0466733_132992 3300042659 Bacteria 10463
82 Ga0562379_0101 3300056790 Unclassified 290205
83 Ga0562375_0003 3300056856 Bacteria 3519784
84 Ga0562374_0019 3300057007 Bacteria 1143430
85 Ga0562374_0231 3300057007 Bacteria 117780
86 Ga0466700_198770 3300042600 Bacteria 6854
87 Ga0466713_047695 3300042602 Bacteria 20316
88 Ga0466716_477400 3300042605 Bacteria 1689
89 Ga0466719_485293 3300042606 Bacteria 7788
90 Ga0466698_395680 3300042610 Bacteria 3739
91 Ga0123357_10037889 3300009784 Bacteria 6564
92 Ga0123357_10234238 3300009784 Bacteria 2004
93 Ga0123353_10090620 3300010167 Bacteria 4924
94 Ga0123353_10364721 3300010167 Bacteria 2169
95 Ga0123353_10575463 3300010167 Bacteria 1617
96 Ga0123353_11107699 3300010167 Bacteria 1050
97 Ga0123354_10086381 3300010882 Unclassified 4385
98 JGI24705J35276_12221277 3300002504 Bacteria 2328
99 Ga0072940_1031775 3300005200 Bacteria 7039
100 Ga0072941_1130277 3300005201 Bacteria 12085
101 Ga0123357_10000129 3300009784 Bacteria 65032
102 Ga0466711_156819 3300042615 Bacteria 42889
103 Ga0466715_088550 3300042616 Bacteria 1467
104 Ga0466703_145495 3300042636 Bacteria 1045
105 Ga0466724_03053 3300042649 Bacteria 12160
106 Ga0466724_09284 3300042649 Bacteria 258546
107 Ga0466708_296074 3300042652 Bacteria 3503
108 Ga0466725_280135 3300042654 Bacteria 3435
109 Ga0160430_110087 3300012852 Unclassified 1651
110 Ga0160435_1011739 3300012857 Bacteria 1776
111 Ga0466691_082815 3300042593 Bacteria 17922
112 Ga0466696_424942 3300042596 Bacteria 3121
113 Ga0562377_0107 3300056842 Bacteria 267817
114 Ga0562376_0535 3300056857 Bacteria 67534
115 Ga0562374_1114 3300057007 Bacteria 34627
116 Ga0466707_385700 3300042601 Bacteria 8107
117 Ga0466713_052761 3300042602 Bacteria 19494
118 Ga0466713_067589 3300042602 Bacteria 2405
119 Ga0466713_124578 3300042602 Bacteria 10521
120 Ga0123357_10005177 3300009784 Bacteria 15560
121 Ga0123353_10586338 3300010167 Unclassified 1598
122 Ga0123354_10009239 3300010882 Bacteria 15074
123 Ga0123354_10063840 3300010882 Bacteria 5408
124 Ga0123354_10095304 3300010882 Unclassified 4074
125 JGI24703J35330_11405413 3300002501 Bacteria 967
126 JGI24699J35502_11033884 3300002509 Bacteria 1528
127 Ga0068302_10112962 3300005071 Bacteria 3251
128 Ga0074278_110322 3300005721 Bacteria 3326
129 Ga0466723_072963 3300042618 Bacteria 1466
130 Ga0466728_307668 3300042620 Bacteria 11705
131 Ga0466708_260681 3300042652 Bacteria 54224
132 Ga0160440_102551 3300012815 Bacteria 1888
133 Ga0160459_100027 3300012831 Bacteria 330422
134 Ga0160452_100417 3300012834 Bacteria 31640
135 Ga0160443_100103 3300012848 Bacteria 135933
136 Ga0160448_106380 3300012854 Bacteria 2959
137 Ga0466693_009130 3300042592 Bacteria 34029
138 Ga0466693_227757 3300042592 Bacteria 1730
139 Ga0562379_0345 3300056790 Bacteria 112065
140 Ga0562375_0006 3300056856 Bacteria 2261894
141 Ga0562376_3727 3300056857 Bacteria 14653
142 Ga0466706_096083 3300042599 Bacteria 14500
143 Ga0466707_080865 3300042601 Bacteria 320076
144 Ga0466713_089892 3300042602 Bacteria 53003
145 Ga0466713_098260 3300042602 Bacteria 3148
146 Ga0466714_094015 3300042603 Bacteria 3398
147 Ga0466720_117273 3300042607 Bacteria 1885
148 Ga0123357_10005393 3300009784 Bacteria 15302
149 Ga0123357_10014616 3300009784 Bacteria 10256
150 Ga0123357_10071560 3300009784 Unclassified 4598
151 Ga0123357_10152993 3300009784 Bacteria 2792
152 Ga0123353_10001458 3300010167 Bacteria 28930
153 Ga0123353_10183888 3300010167 Bacteria 3306
154 Ga0123354_10000833 3300010882 Unclassified 33980
155 2227467000 2225789004 Unclassified 960
156 JGI24699J35502_11132904 3300002509 Bacteria 7929
157 Ga0466728_061184 3300042620 Bacteria 1441
158 Ga0466730_093621 3300042625 Bacteria 3603
159 Ga0466703_120402 3300042636 Bacteria 2720
160 Ga0466703_429854 3300042636 Bacteria 20675
161 Ga0466704_060685 3300042643 Bacteria 2294
162 Ga0466724_46140 3300042649 Bacteria 630192
163 Ga0466724_61460 3300042649 Bacteria 1119
164 Ga0466727_097626 3300042655 Bacteria 3018
165 Ga0160432_100749 3300012818 Bacteria 16191
166 Ga0160432_102207 3300012818 Bacteria 4537
167 Ga0160443_100179 3300012848 Bacteria 86080
168 Ga0466692_002434 3300042591 Bacteria 6265
169 Ga0466693_338701 3300042592 Bacteria 160829
170 Ga0466696_052493 3300042596 Bacteria 3315
171 Ga0562375_2596 3300056856 Unclassified 19677
172 Ga0562376_0617 3300056857 Bacteria 60617
173 Ga0562376_0646 3300056857 Bacteria 58762
174 Ga0466706_101513 3300042599 Bacteria 10282
175 Ga0466706_109889 3300042599 Bacteria 2876
176 Ga0466706_135085 3300042599 Bacteria 7816
177 Ga0466707_042117 3300042601 Bacteria 143034
178 Ga0466707_205161 3300042601 Bacteria 5901
179 Ga0466716_052736 3300042605 Bacteria 1061
180 Ga0466719_068582 3300042606 Bacteria 11999
181 Ga0466719_470985 3300042606 Bacteria 1910
182 Ga0466722_071386 3300042609 Bacteria 17757
183 Ga0123357_10129072 3300009784 Bacteria 3155
184 Ga0123357_10131416 3300009784 Bacteria 3115
185 Ga0123357_10248802 3300009784 Bacteria 1907
186 Ga0123356_10010003 3300010049 Bacteria 9335
187 Ga0123354_10014730 3300010882 Bacteria 12178
188 Ga0160471_104799 3300012812 Bacteria 1857
189 Ga0068305_10017877 3300005083 Bacteria 3871
190 Ga0466723_120188 3300042618 Bacteria 25242
191 Ga0466705_118059 3300042612 Bacteria 12122
192 Ga0466705_153054 3300042612 Bacteria 6327
193 Ga0466705_302163 3300042612 Bacteria 2441
194 Ga0466703_198394 3300042636 Bacteria 12573
195 Ga0466703_275434 3300042636 Bacteria 36391
196 Ga0466704_332475 3300042643 Bacteria 7745
197 Ga0466727_218641 3300042655 Bacteria 17171
198 Ga0160432_100781 3300012818 Unclassified 15208
199 Ga0160445_100011 3300012847 Bacteria 286054
200 Ga0160434_100015 3300012850 Bacteria 213534
201 Ga0160457_1000016 3300012858 Bacteria 412496
202 Ga0466696_297155 3300042596 Bacteria 2761
203 Ga0466696_305616 3300042596 Bacteria 1980
204 Ga0562378_0130 3300056814 Unclassified 194396
205 Ga0562375_0002 3300056856 Bacteria 3523859
206 Ga0562375_1459 3300056856 Bacteria 31780
207 Ga0562375_3568 3300056856 Bacteria 14214
208 Ga0466707_234248 3300042601 Bacteria 8036
209 Ga0466713_003272 3300042602 Bacteria 104907
210 Ga0466713_115666 3300042602 Bacteria 22255
211 Ga0466713_155674 3300042602 Bacteria 1428
212 Ga0466717_209388 3300042604 Bacteria 6888
213 Ga0466716_274257 3300042605 Bacteria 13960
214 Ga0466722_255643 3300042609 Bacteria 1367
215 Ga0123353_10115009 3300010167 Bacteria 4330
216 Ga0123354_10250171 3300010882 Bacteria 1798
217 JGI24699J35502_11132018 3300002509 Unclassified 6282
218 Ga0123357_10000120 3300009784 Bacteria 66802
219 Ga0466710_167270 3300042613 Bacteria 5850
220 Ga0466730_046187 3300042625 Bacteria 9232
221 Ga0160458_106447 3300012832 Unclassified 1374
222 Ga0160455_100842 3300012837 Bacteria 11859
223 Ga0160430_101858 3300012852 Bacteria 7292
224 Ga0160435_1001863 3300012857 Bacteria 5201

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00696 AA_kinase Amino acid kinase family 48 255 0.94

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.