Protein Family IF07936
Metagenome
Isolate
362
Members
212
Samples
224
Scaffolds
243.11
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_104812|Ga0466718_104812_1117_1956
- Length
- 279 aa
- Sequence
- MHDDAAAARRNSTPGSGASARGHASFPPGSDDDVLHASAPGDGSKPRRVLLKLSGEAFGGGQMGVDAYVVRRIAEEIAVAVKQGVQVAVVVGGGNYFRGADLAQAGMQRERADYMGMLGTVMNCLSLQDFLEKDGVATRVQTAIAMGQVAEPYIPLRAIRHLEKGRVVIFGAGAGLPYFSTDTVAIQRALEIGCDEVLMGKNGVDGVYDADPNKVSGATKFDHLTFDEALERKLAVMDSTAMAMARDNGVHMRVFGLEGYGNVTKSLLGEKIGTEVTPN
Sample Types
Isolate
38.1%
Metagenome
61.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
34.5%
Termitidae
14.0%
Apidae
9.0%
Kalotermitidae
6.0%
Anthocoridae
5.0%
Culicidae
5.0%
Cambaridae
4.5%
Tenebrionidae
3.5%
Scarabaeidae
3.0%
Armadillidiidae
2.0%
Formicidae
2.0%
Hydrophilidae
2.0%
Dytiscidae
2.0%
Rhinotermitidae
1.5%
Curculionidae
1.0%
Termopsidae
1.0%
Chironomidae
0.5%
Ixodidae
0.5%
Siricidae
0.5%
Passalidae
0.5%
Pentatomidae
0.5%
Pyralidae
0.5%
Hodotermitidae
0.5%
Cerambycidae
0.5%
Taxonomy
Archaea
0
Bacteria
341
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 6 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 7 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 8 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 9 | 2820929059 | Unclassified Actinobacteria Emb289P3bin110 | Isolate | Unclassified |
| 10 | 2821314491 | Unclassified Actinobacteria Lab288P4bin49 | Isolate | Unclassified |
| 11 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 12 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 13 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 14 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 15 | 2909412500 | Yimella sp. cx-573 | Isolate | Cambaridae |
| 16 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 17 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 18 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 19 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 20 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 21 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 22 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 23 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 24 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 25 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 26 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 27 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 34 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 35 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 36 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 37 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 38 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 39 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 40 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 41 | 2597490239 | Bifidobacterium bohemicum DSM 22767 | Isolate | Unclassified |
| 42 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 43 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 44 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 45 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 46 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 47 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 48 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 49 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 50 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 51 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 52 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 53 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 56 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 57 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 58 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 59 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 60 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 61 | 8062637095 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 62 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 63 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 64 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 65 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 66 | 2820807258 | Unclassified Actinobacteria Nt197P3bin90 | Isolate | Unclassified |
| 67 | 2820818506 | Unclassified Actinobacteria Nt197P3bin3 | Isolate | Unclassified |
| 68 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 69 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 70 | 2820889385 | Unclassified Actinobacteria Lab288P1bin133 | Isolate | Unclassified |
| 71 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 72 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 73 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 74 | 2865982043 | Bifidobacterium aemilianum XV10 | Isolate | Apidae |
| 75 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 76 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 77 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 78 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 79 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 80 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 81 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 82 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 83 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 84 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 85 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 86 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 87 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 88 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 89 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 90 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 91 | 2818991320 | Klugiella xanthotipulae DSM 18031 | Isolate | Unclassified |
| 92 | 2820834831 | Unclassified Actinobacteria Lab288P4bin79 | Isolate | Unclassified |
| 93 | 2820840446 | Unclassified Actinobacteria Lab288P4bin17 | Isolate | Unclassified |
| 94 | 2820857933 | Unclassified Actinobacteria Lab288P3bin173 | Isolate | Unclassified |
| 95 | 2820863028 | Unclassified Actinobacteria Lab288P3bin164 | Isolate | Unclassified |
| 96 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 97 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 98 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 99 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 100 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 101 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 102 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 103 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 104 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 105 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 106 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 107 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 108 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 109 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 110 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 111 | 2065487017 | Actinobacterium Actino7 (unscreened) | Isolate | Unclassified |
| 112 | 8062747827 | Yimella sp. cx-51 | Isolate | Cambaridae |
| 113 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 114 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 115 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 116 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 117 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 118 | 2820867525 | Unclassified Actinobacteria Lab288P3bin128 | Isolate | Unclassified |
| 119 | 2820903739 | Unclassified Actinobacteria Emb289P4bin49 | Isolate | Unclassified |
| 120 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 121 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 122 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 123 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 124 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 125 | 2912749649 | Streptomyces sp. GS7 | Isolate | Termitidae |
| 126 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 127 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 128 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 129 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 130 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 131 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 132 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 133 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 134 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 135 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 136 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 137 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 138 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 139 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 140 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 141 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 142 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 143 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 144 | 2820820509 | Unclassified Actinobacteria Nt197P3bin23 | Isolate | Unclassified |
| 145 | 2820882373 | Unclassified Actinobacteria Lab288P1bin45 | Isolate | Unclassified |
| 146 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 147 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 148 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 149 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 150 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 151 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 152 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 153 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 154 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 155 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 156 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 157 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 158 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 159 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 160 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 161 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 162 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 163 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 164 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 165 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 166 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 167 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 168 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 169 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 170 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 171 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 172 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 173 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 174 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 175 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 176 | 2820816657 | Unclassified Actinobacteria Nt197P3bin38 | Isolate | Unclassified |
| 177 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 178 | 2820944107 | Unclassified Actinobacteria Cu122P5bin14 | Isolate | Unclassified |
| 179 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 180 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 181 | 2915157839 | Leucobacter sp. cx-42 | Isolate | Cambaridae |
| 182 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 183 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 184 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 185 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 186 | 2734481968 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 187 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 188 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 189 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 190 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 191 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 192 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 193 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 194 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 195 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 196 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 197 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 198 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 199 | 2820829137 | Unclassified Actinobacteria Nc150P5bin2 | Isolate | Unclassified |
| 200 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 201 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 202 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 203 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 204 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 205 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 206 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 207 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 208 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 209 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 210 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 211 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 212 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_087265 | 3300042659 | Bacteria | 208960 |
| 2 | Ga0562378_0051 | 3300056814 | Bacteria | 353762 |
| 3 | Ga0466706_219179 | 3300042599 | Bacteria | 2053 |
| 4 | Ga0466707_293698 | 3300042601 | Unclassified | 5019 |
| 5 | Ga0466713_156644 | 3300042602 | Bacteria | 21718 |
| 6 | Ga0123357_10044902 | 3300009784 | Bacteria | 5997 |
| 7 | Ga0123357_10236827 | 3300009784 | Bacteria | 1986 |
| 8 | Ga0123357_10522062 | 3300009784 | Bacteria | 969 |
| 9 | Ga0123355_10565355 | 3300009826 | Bacteria | 1367 |
| 10 | Ga0123356_10011427 | 3300010049 | Bacteria | 8655 |
| 11 | Ga0123356_10399299 | 3300010049 | Bacteria | 1512 |
| 12 | Ga0123356_10829441 | 3300010049 | Bacteria | 1096 |
| 13 | Ga0123353_10004539 | 3300010167 | Bacteria | 17893 |
| 14 | Ga0123353_10277489 | 3300010167 | Bacteria | 2577 |
| 15 | Ga0123354_10235693 | 3300010882 | Bacteria | 1899 |
| 16 | JGI24705J35276_12172389 | 3300002504 | Bacteria | 1303 |
| 17 | JGI24705J35276_12228570 | 3300002504 | Bacteria | 3210 |
| 18 | JGI24699J35502_11133956 | 3300002509 | Bacteria | 21193 |
| 19 | Ga0072940_1069746 | 3300005200 | Bacteria | 17264 |
| 20 | Ga0072941_1356427 | 3300005201 | Bacteria | 1408 |
| 21 | Ga0123357_10001404 | 3300009784 | Bacteria | 25509 |
| 22 | Ga0466718_038545 | 3300042617 | Bacteria | 12057 |
| 23 | Ga0466723_168678 | 3300042618 | Bacteria | 2975 |
| 24 | Ga0466723_235819 | 3300042618 | Bacteria | 8013 |
| 25 | Ga0466728_355614 | 3300042620 | Bacteria | 1807 |
| 26 | Ga0466705_055335 | 3300042612 | Bacteria | 2044 |
| 27 | Ga0466704_312945 | 3300042643 | Bacteria | 75035 |
| 28 | Ga0466704_599028 | 3300042643 | Bacteria | 5940 |
| 29 | Ga0160460_102857 | 3300012845 | Unclassified | 3481 |
| 30 | Ga0160447_100799 | 3300012849 | Bacteria | 13531 |
| 31 | Ga0160434_100775 | 3300012850 | Unclassified | 7192 |
| 32 | Ga0562379_0016 | 3300056790 | Bacteria | 1192610 |
| 33 | Ga0562376_0079 | 3300056857 | Bacteria | 227259 |
| 34 | Ga0562374_0551 | 3300057007 | Bacteria | 60750 |
| 35 | Ga0123357_10024387 | 3300009784 | Bacteria | 8142 |
| 36 | Ga0123357_10243953 | 3300009784 | Bacteria | 1939 |
| 37 | Ga0123356_10000150 | 3300010049 | Bacteria | 78432 |
| 38 | Ga0123356_10005036 | 3300010049 | Bacteria | 13539 |
| 39 | Ga0123356_10009253 | 3300010049 | Bacteria | 9733 |
| 40 | Ga0123354_10002262 | 3300010882 | Bacteria | 25152 |
| 41 | AustNasuHG_c1000174 | 3300000089 | Bacteria | 20828 |
| 42 | JGI24699J35502_11132553 | 3300002509 | Bacteria | 7077 |
| 43 | Ga0123357_10000214 | 3300009784 | Bacteria | 54542 |
| 44 | Ga0466705_490321 | 3300042612 | Unclassified | 1494 |
| 45 | Ga0466710_241925 | 3300042613 | Bacteria | 2037 |
| 46 | Ga0466723_108690 | 3300042618 | Bacteria | 2848 |
| 47 | Ga0466705_324004 | 3300042612 | Bacteria | 1408 |
| 48 | Ga0466729_254167 | 3300042621 | Bacteria | 1788 |
| 49 | Ga0466734_128942 | 3300042623 | Bacteria | 1713 |
| 50 | Ga0466703_225395 | 3300042636 | Bacteria | 58668 |
| 51 | Ga0466703_418179 | 3300042636 | Unclassified | 2811 |
| 52 | Ga0160458_100016 | 3300012832 | Bacteria | 326466 |
| 53 | Ga0160446_100089 | 3300012835 | Unclassified | 86986 |
| 54 | Ga0466696_163402 | 3300042596 | Bacteria | 3031 |
| 55 | Ga0466696_461538 | 3300042596 | Bacteria | 3138 |
| 56 | Ga0562379_0115 | 3300056790 | Unclassified | 253623 |
| 57 | Ga0562379_0375 | 3300056790 | Bacteria | 102463 |
| 58 | Ga0562375_0311 | 3300056856 | Bacteria | 119686 |
| 59 | Ga0466713_111704 | 3300042602 | Bacteria | 1241 |
| 60 | Ga0466713_122468 | 3300042602 | Bacteria | 4518 |
| 61 | Ga0466719_138891 | 3300042606 | Bacteria | 99480 |
| 62 | Ga0123356_10022293 | 3300010049 | Unclassified | 5981 |
| 63 | Ga0123356_10029100 | 3300010049 | Bacteria | 5174 |
| 64 | Ga0123354_10000030 | 3300010882 | Bacteria | 106941 |
| 65 | Ga0123354_10088571 | 3300010882 | Bacteria | 4304 |
| 66 | Ga0102734_1000022 | 3300007129 | Bacteria | 50061 |
| 67 | Ga0466718_104812 | 3300042617 | Bacteria | 3663 |
| 68 | Ga0466728_138990 | 3300042620 | Bacteria | 17577 |
| 69 | Ga0466728_336806 | 3300042620 | Bacteria | 16466 |
| 70 | Ga0466705_058081 | 3300042612 | Bacteria | 3765 |
| 71 | Ga0466705_091340 | 3300042612 | Bacteria | 15065 |
| 72 | Ga0466703_033530 | 3300042636 | Bacteria | 14410 |
| 73 | Ga0160453_104730 | 3300012814 | Bacteria | 2407 |
| 74 | Ga0160441_100619 | 3300012825 | Bacteria | 22203 |
| 75 | Ga0160431_101341 | 3300012828 | Bacteria | 7207 |
| 76 | Ga0160452_100032 | 3300012834 | Bacteria | 218733 |
| 77 | Ga0160443_100006 | 3300012848 | Bacteria | 647325 |
| 78 | Ga0466696_057045 | 3300042596 | Bacteria | 1417 |
| 79 | Ga0466696_247362 | 3300042596 | Bacteria | 5100 |
| 80 | Ga0466696_506409 | 3300042596 | Bacteria | 4184 |
| 81 | Ga0466733_132992 | 3300042659 | Bacteria | 10463 |
| 82 | Ga0562379_0101 | 3300056790 | Unclassified | 290205 |
| 83 | Ga0562375_0003 | 3300056856 | Bacteria | 3519784 |
| 84 | Ga0562374_0019 | 3300057007 | Bacteria | 1143430 |
| 85 | Ga0562374_0231 | 3300057007 | Bacteria | 117780 |
| 86 | Ga0466700_198770 | 3300042600 | Bacteria | 6854 |
| 87 | Ga0466713_047695 | 3300042602 | Bacteria | 20316 |
| 88 | Ga0466716_477400 | 3300042605 | Bacteria | 1689 |
| 89 | Ga0466719_485293 | 3300042606 | Bacteria | 7788 |
| 90 | Ga0466698_395680 | 3300042610 | Bacteria | 3739 |
| 91 | Ga0123357_10037889 | 3300009784 | Bacteria | 6564 |
| 92 | Ga0123357_10234238 | 3300009784 | Bacteria | 2004 |
| 93 | Ga0123353_10090620 | 3300010167 | Bacteria | 4924 |
| 94 | Ga0123353_10364721 | 3300010167 | Bacteria | 2169 |
| 95 | Ga0123353_10575463 | 3300010167 | Bacteria | 1617 |
| 96 | Ga0123353_11107699 | 3300010167 | Bacteria | 1050 |
| 97 | Ga0123354_10086381 | 3300010882 | Unclassified | 4385 |
| 98 | JGI24705J35276_12221277 | 3300002504 | Bacteria | 2328 |
| 99 | Ga0072940_1031775 | 3300005200 | Bacteria | 7039 |
| 100 | Ga0072941_1130277 | 3300005201 | Bacteria | 12085 |
| 101 | Ga0123357_10000129 | 3300009784 | Bacteria | 65032 |
| 102 | Ga0466711_156819 | 3300042615 | Bacteria | 42889 |
| 103 | Ga0466715_088550 | 3300042616 | Bacteria | 1467 |
| 104 | Ga0466703_145495 | 3300042636 | Bacteria | 1045 |
| 105 | Ga0466724_03053 | 3300042649 | Bacteria | 12160 |
| 106 | Ga0466724_09284 | 3300042649 | Bacteria | 258546 |
| 107 | Ga0466708_296074 | 3300042652 | Bacteria | 3503 |
| 108 | Ga0466725_280135 | 3300042654 | Bacteria | 3435 |
| 109 | Ga0160430_110087 | 3300012852 | Unclassified | 1651 |
| 110 | Ga0160435_1011739 | 3300012857 | Bacteria | 1776 |
| 111 | Ga0466691_082815 | 3300042593 | Bacteria | 17922 |
| 112 | Ga0466696_424942 | 3300042596 | Bacteria | 3121 |
| 113 | Ga0562377_0107 | 3300056842 | Bacteria | 267817 |
| 114 | Ga0562376_0535 | 3300056857 | Bacteria | 67534 |
| 115 | Ga0562374_1114 | 3300057007 | Bacteria | 34627 |
| 116 | Ga0466707_385700 | 3300042601 | Bacteria | 8107 |
| 117 | Ga0466713_052761 | 3300042602 | Bacteria | 19494 |
| 118 | Ga0466713_067589 | 3300042602 | Bacteria | 2405 |
| 119 | Ga0466713_124578 | 3300042602 | Bacteria | 10521 |
| 120 | Ga0123357_10005177 | 3300009784 | Bacteria | 15560 |
| 121 | Ga0123353_10586338 | 3300010167 | Unclassified | 1598 |
| 122 | Ga0123354_10009239 | 3300010882 | Bacteria | 15074 |
| 123 | Ga0123354_10063840 | 3300010882 | Bacteria | 5408 |
| 124 | Ga0123354_10095304 | 3300010882 | Unclassified | 4074 |
| 125 | JGI24703J35330_11405413 | 3300002501 | Bacteria | 967 |
| 126 | JGI24699J35502_11033884 | 3300002509 | Bacteria | 1528 |
| 127 | Ga0068302_10112962 | 3300005071 | Bacteria | 3251 |
| 128 | Ga0074278_110322 | 3300005721 | Bacteria | 3326 |
| 129 | Ga0466723_072963 | 3300042618 | Bacteria | 1466 |
| 130 | Ga0466728_307668 | 3300042620 | Bacteria | 11705 |
| 131 | Ga0466708_260681 | 3300042652 | Bacteria | 54224 |
| 132 | Ga0160440_102551 | 3300012815 | Bacteria | 1888 |
| 133 | Ga0160459_100027 | 3300012831 | Bacteria | 330422 |
| 134 | Ga0160452_100417 | 3300012834 | Bacteria | 31640 |
| 135 | Ga0160443_100103 | 3300012848 | Bacteria | 135933 |
| 136 | Ga0160448_106380 | 3300012854 | Bacteria | 2959 |
| 137 | Ga0466693_009130 | 3300042592 | Bacteria | 34029 |
| 138 | Ga0466693_227757 | 3300042592 | Bacteria | 1730 |
| 139 | Ga0562379_0345 | 3300056790 | Bacteria | 112065 |
| 140 | Ga0562375_0006 | 3300056856 | Bacteria | 2261894 |
| 141 | Ga0562376_3727 | 3300056857 | Bacteria | 14653 |
| 142 | Ga0466706_096083 | 3300042599 | Bacteria | 14500 |
| 143 | Ga0466707_080865 | 3300042601 | Bacteria | 320076 |
| 144 | Ga0466713_089892 | 3300042602 | Bacteria | 53003 |
| 145 | Ga0466713_098260 | 3300042602 | Bacteria | 3148 |
| 146 | Ga0466714_094015 | 3300042603 | Bacteria | 3398 |
| 147 | Ga0466720_117273 | 3300042607 | Bacteria | 1885 |
| 148 | Ga0123357_10005393 | 3300009784 | Bacteria | 15302 |
| 149 | Ga0123357_10014616 | 3300009784 | Bacteria | 10256 |
| 150 | Ga0123357_10071560 | 3300009784 | Unclassified | 4598 |
| 151 | Ga0123357_10152993 | 3300009784 | Bacteria | 2792 |
| 152 | Ga0123353_10001458 | 3300010167 | Bacteria | 28930 |
| 153 | Ga0123353_10183888 | 3300010167 | Bacteria | 3306 |
| 154 | Ga0123354_10000833 | 3300010882 | Unclassified | 33980 |
| 155 | 2227467000 | 2225789004 | Unclassified | 960 |
| 156 | JGI24699J35502_11132904 | 3300002509 | Bacteria | 7929 |
| 157 | Ga0466728_061184 | 3300042620 | Bacteria | 1441 |
| 158 | Ga0466730_093621 | 3300042625 | Bacteria | 3603 |
| 159 | Ga0466703_120402 | 3300042636 | Bacteria | 2720 |
| 160 | Ga0466703_429854 | 3300042636 | Bacteria | 20675 |
| 161 | Ga0466704_060685 | 3300042643 | Bacteria | 2294 |
| 162 | Ga0466724_46140 | 3300042649 | Bacteria | 630192 |
| 163 | Ga0466724_61460 | 3300042649 | Bacteria | 1119 |
| 164 | Ga0466727_097626 | 3300042655 | Bacteria | 3018 |
| 165 | Ga0160432_100749 | 3300012818 | Bacteria | 16191 |
| 166 | Ga0160432_102207 | 3300012818 | Bacteria | 4537 |
| 167 | Ga0160443_100179 | 3300012848 | Bacteria | 86080 |
| 168 | Ga0466692_002434 | 3300042591 | Bacteria | 6265 |
| 169 | Ga0466693_338701 | 3300042592 | Bacteria | 160829 |
| 170 | Ga0466696_052493 | 3300042596 | Bacteria | 3315 |
| 171 | Ga0562375_2596 | 3300056856 | Unclassified | 19677 |
| 172 | Ga0562376_0617 | 3300056857 | Bacteria | 60617 |
| 173 | Ga0562376_0646 | 3300056857 | Bacteria | 58762 |
| 174 | Ga0466706_101513 | 3300042599 | Bacteria | 10282 |
| 175 | Ga0466706_109889 | 3300042599 | Bacteria | 2876 |
| 176 | Ga0466706_135085 | 3300042599 | Bacteria | 7816 |
| 177 | Ga0466707_042117 | 3300042601 | Bacteria | 143034 |
| 178 | Ga0466707_205161 | 3300042601 | Bacteria | 5901 |
| 179 | Ga0466716_052736 | 3300042605 | Bacteria | 1061 |
| 180 | Ga0466719_068582 | 3300042606 | Bacteria | 11999 |
| 181 | Ga0466719_470985 | 3300042606 | Bacteria | 1910 |
| 182 | Ga0466722_071386 | 3300042609 | Bacteria | 17757 |
| 183 | Ga0123357_10129072 | 3300009784 | Bacteria | 3155 |
| 184 | Ga0123357_10131416 | 3300009784 | Bacteria | 3115 |
| 185 | Ga0123357_10248802 | 3300009784 | Bacteria | 1907 |
| 186 | Ga0123356_10010003 | 3300010049 | Bacteria | 9335 |
| 187 | Ga0123354_10014730 | 3300010882 | Bacteria | 12178 |
| 188 | Ga0160471_104799 | 3300012812 | Bacteria | 1857 |
| 189 | Ga0068305_10017877 | 3300005083 | Bacteria | 3871 |
| 190 | Ga0466723_120188 | 3300042618 | Bacteria | 25242 |
| 191 | Ga0466705_118059 | 3300042612 | Bacteria | 12122 |
| 192 | Ga0466705_153054 | 3300042612 | Bacteria | 6327 |
| 193 | Ga0466705_302163 | 3300042612 | Bacteria | 2441 |
| 194 | Ga0466703_198394 | 3300042636 | Bacteria | 12573 |
| 195 | Ga0466703_275434 | 3300042636 | Bacteria | 36391 |
| 196 | Ga0466704_332475 | 3300042643 | Bacteria | 7745 |
| 197 | Ga0466727_218641 | 3300042655 | Bacteria | 17171 |
| 198 | Ga0160432_100781 | 3300012818 | Unclassified | 15208 |
| 199 | Ga0160445_100011 | 3300012847 | Bacteria | 286054 |
| 200 | Ga0160434_100015 | 3300012850 | Bacteria | 213534 |
| 201 | Ga0160457_1000016 | 3300012858 | Bacteria | 412496 |
| 202 | Ga0466696_297155 | 3300042596 | Bacteria | 2761 |
| 203 | Ga0466696_305616 | 3300042596 | Bacteria | 1980 |
| 204 | Ga0562378_0130 | 3300056814 | Unclassified | 194396 |
| 205 | Ga0562375_0002 | 3300056856 | Bacteria | 3523859 |
| 206 | Ga0562375_1459 | 3300056856 | Bacteria | 31780 |
| 207 | Ga0562375_3568 | 3300056856 | Bacteria | 14214 |
| 208 | Ga0466707_234248 | 3300042601 | Bacteria | 8036 |
| 209 | Ga0466713_003272 | 3300042602 | Bacteria | 104907 |
| 210 | Ga0466713_115666 | 3300042602 | Bacteria | 22255 |
| 211 | Ga0466713_155674 | 3300042602 | Bacteria | 1428 |
| 212 | Ga0466717_209388 | 3300042604 | Bacteria | 6888 |
| 213 | Ga0466716_274257 | 3300042605 | Bacteria | 13960 |
| 214 | Ga0466722_255643 | 3300042609 | Bacteria | 1367 |
| 215 | Ga0123353_10115009 | 3300010167 | Bacteria | 4330 |
| 216 | Ga0123354_10250171 | 3300010882 | Bacteria | 1798 |
| 217 | JGI24699J35502_11132018 | 3300002509 | Unclassified | 6282 |
| 218 | Ga0123357_10000120 | 3300009784 | Bacteria | 66802 |
| 219 | Ga0466710_167270 | 3300042613 | Bacteria | 5850 |
| 220 | Ga0466730_046187 | 3300042625 | Bacteria | 9232 |
| 221 | Ga0160458_106447 | 3300012832 | Unclassified | 1374 |
| 222 | Ga0160455_100842 | 3300012837 | Bacteria | 11859 |
| 223 | Ga0160430_101858 | 3300012852 | Bacteria | 7292 |
| 224 | Ga0160435_1001863 | 3300012857 | Bacteria | 5201 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00696 | AA_kinase | Amino acid kinase family | 48 | 255 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.