Protein Family IF07933
Metagenome
Isolate
218
Members
58
Samples
204
Scaffolds
238.67
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_100064|Ga0466718_100064_1701_2558
- Length
- 285 aa
- Sequence
- MNENNRSGGEPRPPVSAAGSGLLARGEEMINKLDRKHSVYGMYPDQPRAADAIIRVRYLVKNYISGAETLHILRGINFEAAYGSAVAVSGQSGSGKSTFLNIIGGLDYPDSGTVEVAGTDITDLSESGLSSYRQRRIGFIFQFHYLLKDFTALENVMLPAYMIGLRKKDAIEKARVLLEDMKLSGRTEHYPSQLSGGERQRVAVARAMVNDPDIILADEPTGNLDPGNSAMVAELLYAGAEKWGKTLIVVTHDETVACRAKICYTLEGGILSCGSGPARNEGVLP
Sample Types
Isolate
6.4%
Metagenome
93.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.3%
Unclassified
26.8%
Kalotermitidae
25.0%
Rhinotermitidae
5.4%
Termopsidae
3.6%
Taxonomy
Archaea
0
Bacteria
212
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 12 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 13 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 14 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 15 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 26 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 27 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 30 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 31 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 32 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 42 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 43 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 44 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 45 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 46 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 47 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 48 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 52 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 58 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_341583 | 3300042612 | Bacteria | 5874 |
| 2 | Ga0466733_055788 | 3300042659 | Bacteria | 32943 |
| 3 | Ga0123356_10000191 | 3300010049 | Bacteria | 70964 |
| 4 | Ga0123356_10010961 | 3300010049 | Bacteria | 8855 |
| 5 | Ga0466704_399934 | 3300042643 | Unclassified | 2159 |
| 6 | Ga0466704_582104 | 3300042643 | Bacteria | 10224 |
| 7 | Ga0466712_188540 | 3300042614 | Bacteria | 1241 |
| 8 | Ga0466715_069257 | 3300042616 | Bacteria | 34190 |
| 9 | Ga0466723_260481 | 3300042618 | Bacteria | 12284 |
| 10 | Ga0466723_308761 | 3300042618 | Bacteria | 24583 |
| 11 | Ga0466726_086676 | 3300042619 | Bacteria | 9773 |
| 12 | Ga0415639_173584 | 3300038395 | Bacteria | 3930 |
| 13 | Ga0466694_123331 | 3300042594 | Bacteria | 14534 |
| 14 | Ga0466694_180912 | 3300042594 | Bacteria | 1966 |
| 15 | Ga0466694_181192 | 3300042594 | Bacteria | 3569 |
| 16 | Ga0466696_028247 | 3300042596 | Bacteria | 4122 |
| 17 | Ga0466699_017746 | 3300042597 | Bacteria | 1002 |
| 18 | Ga0466699_104033 | 3300042597 | Bacteria | 26132 |
| 19 | Ga0466699_199022 | 3300042597 | Bacteria | 5158 |
| 20 | Ga0466699_222523 | 3300042597 | Bacteria | 2953 |
| 21 | Ga0466699_438601 | 3300042597 | Bacteria | 2825 |
| 22 | JGI24698J34947_10000486 | 3300002449 | Bacteria | 18665 |
| 23 | JGI24695J34938_10000063 | 3300002450 | Bacteria | 87942 |
| 24 | JGI24695J34938_10002085 | 3300002450 | Bacteria | 15669 |
| 25 | Ga0072941_1073196 | 3300005201 | Bacteria | 6962 |
| 26 | Ga0466705_253179 | 3300042612 | Bacteria | 2541 |
| 27 | Ga0466722_209631 | 3300042609 | Bacteria | 1655 |
| 28 | Ga0123355_10137056 | 3300009826 | Bacteria | 3756 |
| 29 | Ga0123356_10000451 | 3300010049 | Bacteria | 46145 |
| 30 | Ga0123353_10618173 | 3300010167 | Bacteria | 1543 |
| 31 | Ga0466708_043056 | 3300042652 | Bacteria | 19401 |
| 32 | Ga0466712_002768 | 3300042614 | Bacteria | 7245 |
| 33 | Ga0466712_102720 | 3300042614 | Bacteria | 25986 |
| 34 | Ga0466712_139191 | 3300042614 | Bacteria | 6077 |
| 35 | Ga0466711_114215 | 3300042615 | Bacteria | 1717 |
| 36 | Ga0466718_047053 | 3300042617 | Bacteria | 9077 |
| 37 | Ga0466723_117615 | 3300042618 | Bacteria | 53992 |
| 38 | Ga0466726_032660 | 3300042619 | Bacteria | 9899 |
| 39 | Ga0466726_320283 | 3300042619 | Bacteria | 1129 |
| 40 | Ga0456237_0001305 | 3300041968 | Bacteria | 3954 |
| 41 | Ga0466694_120831 | 3300042594 | Bacteria | 12472 |
| 42 | Ga0466694_334581 | 3300042594 | Bacteria | 8121 |
| 43 | Ga0466699_076091 | 3300042597 | Bacteria | 13285 |
| 44 | Ga0466699_194997 | 3300042597 | Bacteria | 1152 |
| 45 | JGI24698J34947_10002965 | 3300002449 | Bacteria | 9203 |
| 46 | Ga0466705_119080 | 3300042612 | Bacteria | 13162 |
| 47 | Ga0466732_137253 | 3300042656 | Bacteria | 1803 |
| 48 | Ga0466700_089178 | 3300042600 | Bacteria | 2419 |
| 49 | Ga0466716_517081 | 3300042605 | Bacteria | 8759 |
| 50 | Ga0123357_10007509 | 3300009784 | Bacteria | 13483 |
| 51 | Ga0123357_10074229 | 3300009784 | Bacteria | 4500 |
| 52 | Ga0123353_10297903 | 3300010167 | Bacteria | 2464 |
| 53 | Ga0123353_10970092 | 3300010167 | Bacteria | 1147 |
| 54 | Ga0123354_10146986 | 3300010882 | Bacteria | 2880 |
| 55 | Ga0123354_10175097 | 3300010882 | Bacteria | 2477 |
| 56 | Ga0123354_10466389 | 3300010882 | Bacteria | 1010 |
| 57 | Ga0466731_271581 | 3300042622 | Bacteria | 4894 |
| 58 | Ga0466704_017756 | 3300042643 | Bacteria | 15432 |
| 59 | Ga0466704_066569 | 3300042643 | Bacteria | 3199 |
| 60 | Ga0466709_057267 | 3300042648 | Bacteria | 1764 |
| 61 | Ga0466708_051684 | 3300042652 | Bacteria | 4699 |
| 62 | Ga0466708_157225 | 3300042652 | Bacteria | 4164 |
| 63 | Ga0466708_216873 | 3300042652 | Bacteria | 11799 |
| 64 | Ga0466727_086930 | 3300042655 | Unclassified | 2231 |
| 65 | Ga0466727_121705 | 3300042655 | Bacteria | 2292 |
| 66 | Ga0466715_018975 | 3300042616 | Bacteria | 15600 |
| 67 | Ga0466715_559339 | 3300042616 | Bacteria | 9818 |
| 68 | Ga0466726_426407 | 3300042619 | Bacteria | 3721 |
| 69 | Ga0456237_0000493 | 3300041968 | Bacteria | 6018 |
| 70 | Ga0466690_352707 | 3300042590 | Bacteria | 9829 |
| 71 | Ga0466690_371178 | 3300042590 | Bacteria | 1721 |
| 72 | Ga0466691_010692 | 3300042593 | Bacteria | 45781 |
| 73 | Ga0466699_065288 | 3300042597 | Bacteria | 1703 |
| 74 | JGI24698J34947_10000716 | 3300002449 | Bacteria | 16298 |
| 75 | JGI24698J34947_10035055 | 3300002449 | Bacteria | 2622 |
| 76 | JGI24698J34947_10086017 | 3300002449 | Bacteria | 1458 |
| 77 | Ga0072941_1000338 | 3300005201 | Bacteria | 19315 |
| 78 | Ga0466705_026099 | 3300042612 | Bacteria | 14603 |
| 79 | Ga0466716_052533 | 3300042605 | Bacteria | 9079 |
| 80 | Ga0466719_145174 | 3300042606 | Bacteria | 49253 |
| 81 | Ga0466719_478188 | 3300042606 | Bacteria | 6695 |
| 82 | Ga0466698_417597 | 3300042610 | Bacteria | 1219 |
| 83 | Ga0123355_10920003 | 3300009826 | Bacteria | 946 |
| 84 | Ga0466709_027126 | 3300042648 | Bacteria | 8368 |
| 85 | Ga0466709_338063 | 3300042648 | Bacteria | 8036 |
| 86 | Ga0466712_085194 | 3300042614 | Bacteria | 9852 |
| 87 | Ga0466715_355918 | 3300042616 | Bacteria | 9209 |
| 88 | Ga0466718_062383 | 3300042617 | Bacteria | 4408 |
| 89 | Ga0466718_100064 | 3300042617 | Bacteria | 12863 |
| 90 | Ga0466723_319752 | 3300042618 | Bacteria | 1108 |
| 91 | Ga0466726_469098 | 3300042619 | Bacteria | 1349 |
| 92 | Ga0466690_087965 | 3300042590 | Bacteria | 6203 |
| 93 | Ga0466694_022863 | 3300042594 | Bacteria | 2004 |
| 94 | Ga0466694_094606 | 3300042594 | Bacteria | 1376 |
| 95 | Ga0466696_419175 | 3300042596 | Bacteria | 1623 |
| 96 | Ga0466699_002445 | 3300042597 | Bacteria | 17182 |
| 97 | Ga0466699_124852 | 3300042597 | Bacteria | 7971 |
| 98 | Ga0466699_402929 | 3300042597 | Bacteria | 1242 |
| 99 | AustNasuHG_c1000203 | 3300000089 | Bacteria | 19564 |
| 100 | JGI24698J34947_10000099 | 3300002449 | Bacteria | 29775 |
| 101 | JGI24698J34947_10012090 | 3300002449 | Unclassified | 4737 |
| 102 | JGI24698J34947_10013415 | 3300002449 | Unclassified | 4474 |
| 103 | JGI24698J34947_10113531 | 3300002449 | Bacteria | 1190 |
| 104 | JGI24702J35022_10193006 | 3300002462 | Bacteria | 1162 |
| 105 | Ga0074263_113863 | 3300005485 | Bacteria | 1316 |
| 106 | Ga0466705_111284 | 3300042612 | Bacteria | 9884 |
| 107 | Ga0466707_133240 | 3300042601 | Bacteria | 4130 |
| 108 | Ga0466716_120558 | 3300042605 | Bacteria | 1616 |
| 109 | Ga0123357_10018653 | 3300009784 | Bacteria | 9229 |
| 110 | Ga0123356_10001823 | 3300010049 | Bacteria | 23151 |
| 111 | Ga0123356_10043107 | 3300010049 | Bacteria | 4202 |
| 112 | Ga0123353_10002399 | 3300010167 | Bacteria | 23299 |
| 113 | Ga0123353_11126204 | 3300010167 | Bacteria | 1039 |
| 114 | Ga0466731_132853 | 3300042622 | Bacteria | 3357 |
| 115 | Ga0466703_413343 | 3300042636 | Bacteria | 68476 |
| 116 | Ga0466704_301952 | 3300042643 | Bacteria | 17756 |
| 117 | Ga0466708_005524 | 3300042652 | Bacteria | 9864 |
| 118 | Ga0466712_032446 | 3300042614 | Bacteria | 13488 |
| 119 | Ga0466711_116557 | 3300042615 | Bacteria | 15349 |
| 120 | Ga0466723_039345 | 3300042618 | Bacteria | 22630 |
| 121 | Ga0466723_058123 | 3300042618 | Bacteria | 8843 |
| 122 | Ga0466693_059955 | 3300042592 | Bacteria | 20423 |
| 123 | Ga0466691_000771 | 3300042593 | Bacteria | 8430 |
| 124 | Ga0466694_002155 | 3300042594 | Bacteria | 38089 |
| 125 | Ga0466694_047892 | 3300042594 | Bacteria | 1426 |
| 126 | Ga0466699_416061 | 3300042597 | Bacteria | 10123 |
| 127 | JGI24698J34947_10003789 | 3300002449 | Bacteria | 8239 |
| 128 | JGI24698J34947_10006327 | 3300002449 | Bacteria | 6504 |
| 129 | JGI24698J34947_10029727 | 3300002449 | Bacteria | 2885 |
| 130 | JGI24698J34947_10085617 | 3300002449 | Bacteria | 1464 |
| 131 | Ga0466707_397310 | 3300042601 | Bacteria | 1511 |
| 132 | Ga0466717_288778 | 3300042604 | Bacteria | 1124 |
| 133 | Ga0466722_107644 | 3300042609 | Bacteria | 17605 |
| 134 | Ga0123355_10037621 | 3300009826 | Bacteria | 7869 |
| 135 | Ga0123356_10827052 | 3300010049 | Bacteria | 1097 |
| 136 | Ga0123353_10197205 | 3300010167 | Bacteria | 3172 |
| 137 | Ga0466703_316437 | 3300042636 | Bacteria | 17841 |
| 138 | Ga0466704_021969 | 3300042643 | Bacteria | 4920 |
| 139 | Ga0466712_020912 | 3300042614 | Bacteria | 1290 |
| 140 | Ga0466712_122514 | 3300042614 | Bacteria | 1726 |
| 141 | Ga0466712_316698 | 3300042614 | Bacteria | 32897 |
| 142 | Ga0466715_131171 | 3300042616 | Bacteria | 2189 |
| 143 | Ga0466718_103603 | 3300042617 | Bacteria | 12147 |
| 144 | Ga0466726_126207 | 3300042619 | Bacteria | 6891 |
| 145 | Ga0466726_228901 | 3300042619 | Bacteria | 1492 |
| 146 | Ga0466728_065446 | 3300042620 | Bacteria | 45233 |
| 147 | Ga0264413_110120 | 3300024493 | Bacteria | 7717 |
| 148 | Ga0466696_079274 | 3300042596 | Bacteria | 11056 |
| 149 | Ga0466696_101778 | 3300042596 | Bacteria | 1183 |
| 150 | Ga0466696_480300 | 3300042596 | Bacteria | 1041 |
| 151 | Ga0466699_162892 | 3300042597 | Bacteria | 1601 |
| 152 | JGI24698J34947_10002050 | 3300002449 | Bacteria | 10760 |
| 153 | JGI24698J34947_10004206 | 3300002449 | Bacteria | 7825 |
| 154 | JGI24698J34947_10072068 | 3300002449 | Bacteria | 1655 |
| 155 | JGI24702J35022_10000506 | 3300002462 | Bacteria | 23589 |
| 156 | Ga0072941_1031272 | 3300005201 | Bacteria | 9212 |
| 157 | Ga0466733_057162 | 3300042659 | Bacteria | 7194 |
| 158 | Ga0466707_002559 | 3300042601 | Bacteria | 1483 |
| 159 | Ga0466707_403498 | 3300042601 | Bacteria | 2967 |
| 160 | Ga0466719_199083 | 3300042606 | Bacteria | 19265 |
| 161 | Ga0123356_10004189 | 3300010049 | Bacteria | 14952 |
| 162 | Ga0123356_10257974 | 3300010049 | Bacteria | 1825 |
| 163 | Ga0123356_11313006 | 3300010049 | Bacteria | 886 |
| 164 | Ga0466703_074243 | 3300042636 | Bacteria | 15662 |
| 165 | Ga0466703_099798 | 3300042636 | Bacteria | 8554 |
| 166 | Ga0466727_072870 | 3300042655 | Bacteria | 1978 |
| 167 | Ga0466712_124733 | 3300042614 | Bacteria | 18419 |
| 168 | Ga0466712_153424 | 3300042614 | Bacteria | 3201 |
| 169 | Ga0466715_055859 | 3300042616 | Bacteria | 18639 |
| 170 | Ga0466723_093775 | 3300042618 | Bacteria | 12651 |
| 171 | Ga0466728_064504 | 3300042620 | Bacteria | 11202 |
| 172 | Ga0466694_010879 | 3300042594 | Bacteria | 2382 |
| 173 | Ga0466694_281157 | 3300042594 | Bacteria | 24970 |
| 174 | Ga0466699_094422 | 3300042597 | Bacteria | 12077 |
| 175 | Ga0466699_393627 | 3300042597 | Unclassified | 1645 |
| 176 | JGI24698J34947_10008813 | 3300002449 | Bacteria | 5534 |
| 177 | Ga0466705_234159 | 3300042612 | Bacteria | 9676 |
| 178 | Ga0466700_379726 | 3300042600 | Bacteria | 7658 |
| 179 | Ga0466717_097704 | 3300042604 | Bacteria | 1125 |
| 180 | Ga0466719_415041 | 3300042606 | Bacteria | 20967 |
| 181 | Ga0466722_154573 | 3300042609 | Bacteria | 5072 |
| 182 | Ga0123356_11440409 | 3300010049 | Bacteria | 848 |
| 183 | Ga0123353_10124224 | 3300010167 | Bacteria | 4148 |
| 184 | Ga0123353_10493873 | 3300010167 | Bacteria | 1786 |
| 185 | Ga0123353_10746732 | 3300010167 | Bacteria | 1363 |
| 186 | Ga0466729_205708 | 3300042621 | Bacteria | 2225 |
| 187 | Ga0466709_230244 | 3300042648 | Bacteria | 10623 |
| 188 | Ga0466709_308203 | 3300042648 | Bacteria | 4860 |
| 189 | Ga0466708_022521 | 3300042652 | Bacteria | 3058 |
| 190 | Ga0466712_029419 | 3300042614 | Bacteria | 1703 |
| 191 | Ga0466712_107682 | 3300042614 | Bacteria | 3595 |
| 192 | Ga0466712_274874 | 3300042614 | Bacteria | 10643 |
| 193 | Ga0466712_286192 | 3300042614 | Bacteria | 8706 |
| 194 | Ga0466711_494338 | 3300042615 | Bacteria | 30381 |
| 195 | Ga0466728_023553 | 3300042620 | Bacteria | 8397 |
| 196 | Ga0466690_082312 | 3300042590 | Bacteria | 13471 |
| 197 | Ga0466696_356491 | 3300042596 | Bacteria | 1682 |
| 198 | Ga0466699_142962 | 3300042597 | Bacteria | 6649 |
| 199 | JGI24698J34947_10000293 | 3300002449 | Bacteria | 21712 |
| 200 | JGI24698J34947_10001304 | 3300002449 | Bacteria | 13085 |
| 201 | JGI24698J34947_10003068 | 3300002449 | Bacteria | 9046 |
| 202 | JGI24695J34938_10007453 | 3300002450 | Bacteria | 6402 |
| 203 | JGI24695J34938_10009735 | 3300002450 | Unclassified | 5322 |
| 204 | JGI24702J35022_10001467 | 3300002462 | Bacteria | 14658 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 73 | 221 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.