Protein Family IF07887
Metagenome
Isolate
158
Members
58
Samples
141
Scaffolds
288.47
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_035507|Ga0466718_035507_102_1217
- Length
- 341 aa
- Sequence
- MMPLQKLEKLPRNQRLRKIAKIFAEAENRLCHAIQRQAGGHDGANNINAAELLCFADIIESAAGDPLILPAAGLFKEASVVLRQAAAQEHSGDKTGKIRRALNGIRHVLLAQTGRSQADWDFISGNGRLDPARRHVFDGMAVYLEDIRSPFNVGAMFRSAESFGVQKILLSPFCADPNHARARRTAMGCVEVMPWERRELFPEAGTLPNNVETFGPFFAMETGGIPLAEFLFPRRGLLIAGSEELGVSPRALAAADASLGRVSIPCYGAKGSLKAMLDMIPGMQGQVSEDDIDKADLKRQEAILSSMTRKERANHLIIGPPRRTRIARGSGTINPMLMHHT
Sample Types
Isolate
10.8%
Metagenome
89.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.6%
Unclassified
30.4%
Kalotermitidae
14.3%
Rhinotermitidae
3.6%
Termopsidae
3.6%
Blaberidae
1.8%
Hodotermitidae
1.8%
Taxonomy
Archaea
1
Bacteria
152
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 6 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 7 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 11 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 12 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 13 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 14 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 15 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 18 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 27 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 31 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 32 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 36 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 37 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 39 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 44 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 45 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 46 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 47 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 49 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 50 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 51 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 52 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 53 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 54 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 55 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 56 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 57 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 58 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_191898 | 3300042612 | Bacteria | 13713 |
| 2 | Ga0123356_10000045 | 3300010049 | Bacteria | 131000 |
| 3 | Ga0123356_10003907 | 3300010049 | Bacteria | 15526 |
| 4 | Ga0123356_10009753 | 3300010049 | Bacteria | 9465 |
| 5 | Ga0123353_11175983 | 3300010167 | Bacteria | 1009 |
| 6 | Ga0466720_015513 | 3300042607 | Bacteria | 1762 |
| 7 | Ga0466720_023098 | 3300042607 | Bacteria | 7885 |
| 8 | Ga0466722_242413 | 3300042609 | Bacteria | 4656 |
| 9 | JGI24698J34947_10074634 | 3300002449 | Bacteria | 1615 |
| 10 | JGI24695J34938_10001028 | 3300002450 | Unclassified | 25255 |
| 11 | JGI24695J34938_10001062 | 3300002450 | Bacteria | 24897 |
| 12 | Ga0466712_004738 | 3300042614 | Bacteria | 9840 |
| 13 | Ga0466715_055515 | 3300042616 | Bacteria | 16050 |
| 14 | Ga0466718_011202 | 3300042617 | Bacteria | 12639 |
| 15 | Ga0466705_232343 | 3300042612 | Bacteria | 13233 |
| 16 | Ga0415639_028933 | 3300038395 | Bacteria | 8844 |
| 17 | Ga0415639_099713 | 3300038395 | Bacteria | 1166 |
| 18 | Ga0466692_173902 | 3300042591 | Bacteria | 15167 |
| 19 | Ga0466694_211446 | 3300042594 | Bacteria | 2529 |
| 20 | Ga0466704_399400 | 3300042643 | Bacteria | 5854 |
| 21 | Ga0466727_256944 | 3300042655 | Bacteria | 1280 |
| 22 | Ga0123355_10014171 | 3300009826 | Bacteria | 12448 |
| 23 | Ga0466719_057771 | 3300042606 | Bacteria | 1045 |
| 24 | JGI24698J34947_10053185 | 3300002449 | Bacteria | 2028 |
| 25 | JGI24695J34938_10000457 | 3300002450 | Bacteria | 39704 |
| 26 | JGI24697J35500_11132889 | 3300002507 | Bacteria | 1275 |
| 27 | Ga0072941_1022831 | 3300005201 | Bacteria | 4118 |
| 28 | Ga0072941_1079929 | 3300005201 | Bacteria | 18238 |
| 29 | Ga0466712_215347 | 3300042614 | Bacteria | 4456 |
| 30 | Ga0466715_374586 | 3300042616 | Bacteria | 5088 |
| 31 | Ga0466732_436102 | 3300042656 | Bacteria | 2880 |
| 32 | Ga0415639_008626 | 3300038395 | Bacteria | 3820 |
| 33 | Ga0466694_271966 | 3300042594 | Bacteria | 3961 |
| 34 | Ga0123355_10504681 | 3300009826 | Bacteria | 1490 |
| 35 | Ga0123356_10051977 | 3300010049 | Bacteria | 3811 |
| 36 | Ga0466720_155526 | 3300042607 | Bacteria | 3382 |
| 37 | JGI24698J34947_10012615 | 3300002449 | Bacteria | 4629 |
| 38 | JGI24695J34938_10005390 | 3300002450 | Bacteria | 7985 |
| 39 | JGI24695J34938_10017087 | 3300002450 | Bacteria | 3667 |
| 40 | JGI24695J34938_10039629 | 3300002450 | Bacteria | 2126 |
| 41 | Ga0072941_1058540 | 3300005201 | Bacteria | 1996 |
| 42 | Ga0072941_1190723 | 3300005201 | Bacteria | 2075 |
| 43 | Ga0466712_270394 | 3300042614 | Unclassified | 20542 |
| 44 | Ga0466705_368171 | 3300042612 | Bacteria | 35287 |
| 45 | Ga0466694_394102 | 3300042594 | Bacteria | 1578 |
| 46 | Ga0466699_307556 | 3300042597 | Bacteria | 1924 |
| 47 | Ga0466704_503977 | 3300042643 | Bacteria | 51073 |
| 48 | Ga0123355_10049525 | 3300009826 | Bacteria | 6830 |
| 49 | Ga0123356_10253006 | 3300010049 | Bacteria | 1840 |
| 50 | Ga0123353_10404039 | 3300010167 | Bacteria | 2031 |
| 51 | Ga0466700_073204 | 3300042600 | Bacteria | 1836 |
| 52 | Ga0466719_167452 | 3300042606 | Bacteria | 4456 |
| 53 | Ga0466719_257079 | 3300042606 | Bacteria | 4030 |
| 54 | Ga0466720_137882 | 3300042607 | Bacteria | 6759 |
| 55 | Ga0466720_154795 | 3300042607 | Bacteria | 8639 |
| 56 | Ga0466720_177129 | 3300042607 | Bacteria | 3889 |
| 57 | JGI24695J34938_10000218 | 3300002450 | Bacteria | 55166 |
| 58 | Ga0072941_1040526 | 3300005201 | Bacteria | 2314 |
| 59 | Ga0072941_1130580 | 3300005201 | Bacteria | 1510 |
| 60 | Ga0074263_117496 | 3300005485 | Bacteria | 2537 |
| 61 | Ga0415639_011081 | 3300038395 | Bacteria | 3024 |
| 62 | Ga0466694_378725 | 3300042594 | Bacteria | 1281 |
| 63 | Ga0466702_242097 | 3300042635 | Bacteria | 2428 |
| 64 | Ga0466704_418169 | 3300042643 | Bacteria | 38627 |
| 65 | Ga0466727_301988 | 3300042655 | Bacteria | 2552 |
| 66 | Ga0123357_10322505 | 3300009784 | Bacteria | 1523 |
| 67 | Ga0123355_10079713 | 3300009826 | Bacteria | 5229 |
| 68 | Ga0123356_10256382 | 3300010049 | Bacteria | 1830 |
| 69 | Ga0123356_10534274 | 3300010049 | Bacteria | 1332 |
| 70 | Ga0123354_10033384 | 3300010882 | Bacteria | 8057 |
| 71 | Ga0466720_008733 | 3300042607 | Bacteria | 2325 |
| 72 | Ga0466698_260042 | 3300042610 | Bacteria | 2508 |
| 73 | AustNasuHG_c1041046 | 3300000089 | Bacteria | 1121 |
| 74 | JGI24698J34947_10001275 | 3300002449 | Bacteria | 13195 |
| 75 | JGI24698J34947_10007566 | 3300002449 | Unclassified | 5968 |
| 76 | JGI24698J34947_10017431 | 3300002449 | Bacteria | 3892 |
| 77 | JGI24695J34938_10000886 | 3300002450 | Bacteria | 27653 |
| 78 | JGI24695J34938_10008661 | 3300002450 | Bacteria | 5781 |
| 79 | JGI24695J34938_10012639 | 3300002450 | Bacteria | 4465 |
| 80 | JGI24695J34938_10056771 | 3300002450 | Bacteria | 1686 |
| 81 | Ga0072940_1271291 | 3300005200 | Bacteria | 2176 |
| 82 | Ga0072941_1000314 | 3300005201 | Bacteria | 12864 |
| 83 | Ga0072941_1000316 | 3300005201 | Bacteria | 12866 |
| 84 | Ga0466712_209513 | 3300042614 | Bacteria | 8734 |
| 85 | Ga0466718_013134 | 3300042617 | Bacteria | 11259 |
| 86 | Ga0466718_035507 | 3300042617 | Bacteria | 1322 |
| 87 | Ga0466693_221116 | 3300042592 | Unclassified | 1631 |
| 88 | Ga0466694_324622 | 3300042594 | Bacteria | 3795 |
| 89 | Ga0466694_379947 | 3300042594 | Bacteria | 10958 |
| 90 | Ga0466703_060394 | 3300042636 | Bacteria | 7926 |
| 91 | Ga0466727_254270 | 3300042655 | Bacteria | 1352 |
| 92 | Ga0123356_10024657 | 3300010049 | Bacteria | 5658 |
| 93 | Ga0123353_10399031 | 3300010167 | Bacteria | 2048 |
| 94 | Ga0466707_064563 | 3300042601 | Bacteria | 1238 |
| 95 | Ga0466707_318733 | 3300042601 | Bacteria | 2062 |
| 96 | Ga0466720_200825 | 3300042607 | Bacteria | 2413 |
| 97 | Ga0466722_202638 | 3300042609 | Bacteria | 35532 |
| 98 | JGI24695J34938_10000535 | 3300002450 | Bacteria | 36751 |
| 99 | JGI24695J34938_10004196 | 3300002450 | Bacteria | 9581 |
| 100 | JGI24695J34938_10005238 | 3300002450 | Bacteria | 8176 |
| 101 | JGI24695J34938_10022749 | 3300002450 | Bacteria | 3035 |
| 102 | JGI24695J34938_10024394 | 3300002450 | Bacteria | 2905 |
| 103 | Ga0466712_184003 | 3300042614 | Bacteria | 10108 |
| 104 | Ga0466712_277094 | 3300042614 | Bacteria | 2278 |
| 105 | Ga0466718_100380 | 3300042617 | Bacteria | 8481 |
| 106 | Ga0466726_219687 | 3300042619 | Bacteria | 1677 |
| 107 | Ga0466732_135527 | 3300042656 | Bacteria | 1221 |
| 108 | Ga0466695_136821 | 3300042595 | Bacteria | 14037 |
| 109 | Ga0466699_135595 | 3300042597 | Bacteria | 1136 |
| 110 | Ga0466699_422299 | 3300042597 | Bacteria | 1665 |
| 111 | Ga0466731_032434 | 3300042622 | Bacteria | 5329 |
| 112 | Ga0466727_284728 | 3300042655 | Bacteria | 2154 |
| 113 | Ga0123353_10493368 | 3300010167 | Bacteria | 1787 |
| 114 | JGI24698J34947_10084565 | 3300002449 | Bacteria | 1477 |
| 115 | JGI24695J34938_10000033 | 3300002450 | Bacteria | 103928 |
| 116 | JGI24695J34938_10003831 | 3300002450 | Bacteria | 10216 |
| 117 | JGI24695J34938_10014225 | 3300002450 | Bacteria | 4136 |
| 118 | JGI24695J34938_10016935 | 3300002450 | Bacteria | 3690 |
| 119 | Ga0072941_1017549 | 3300005201 | Bacteria | 10425 |
| 120 | Ga0466712_027829 | 3300042614 | Bacteria | 3777 |
| 121 | Ga0466712_071963 | 3300042614 | Bacteria | 8573 |
| 122 | Ga0466712_126948 | 3300042614 | Bacteria | 15581 |
| 123 | Ga0466718_035592 | 3300042617 | Bacteria | 6716 |
| 124 | Ga0466718_038253 | 3300042617 | Bacteria | 1294 |
| 125 | Ga0264413_120537 | 3300024493 | Bacteria | 7754 |
| 126 | Ga0466702_369380 | 3300042635 | Archaea | 4467 |
| 127 | Ga0466704_006020 | 3300042643 | Bacteria | 1493 |
| 128 | Ga0123356_10040816 | 3300010049 | Bacteria | 4323 |
| 129 | Ga0466706_257741 | 3300042599 | Bacteria | 1672 |
| 130 | Ga0466716_458646 | 3300042605 | Bacteria | 28728 |
| 131 | Ga0466720_063073 | 3300042607 | Bacteria | 19134 |
| 132 | Ga0466720_081343 | 3300042607 | Bacteria | 1729 |
| 133 | Ga0466720_086979 | 3300042607 | Bacteria | 1350 |
| 134 | JGI24698J34947_10012426 | 3300002449 | Bacteria | 4666 |
| 135 | JGI24698J34947_10044588 | 3300002449 | Unclassified | 2269 |
| 136 | JGI24695J34938_10067475 | 3300002450 | Bacteria | 1505 |
| 137 | JGI24702J35022_10009131 | 3300002462 | Bacteria | 5582 |
| 138 | Ga0466712_007854 | 3300042614 | Bacteria | 11262 |
| 139 | Ga0466711_052654 | 3300042615 | Bacteria | 6068 |
| 140 | Ga0466715_272411 | 3300042616 | Bacteria | 10082 |
| 141 | Ga0466723_172156 | 3300042618 | Bacteria | 4457 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.