Protein Family IF07874

Metagenome Metatranscriptome Isolate
292 Members
88 Samples
261 Scaffolds
57.66 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_015932|Ga0466718_015932_1452_1664
Length
70 aa
Sequence
LAVNRFLIVKGLDMASKKQVVELIALQCSECKRRNYTTSKNRRNTQEKLELKKYCPFDRKHTVHKETKVK

📊 Sample Types

Isolate 10.6%
Metagenome 89.0%
MAG 0.0%
Metatranscriptome 0.3%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 38.8%
Termitidae 36.5%
Kalotermitidae 16.5%
Rhinotermitidae 3.5%
Termopsidae 3.5%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 234
Eukaryota 0
Viruses 0
Unclassified 58

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
2 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
3 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
4 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
5 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
6 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
7 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
8 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
9 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
10 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
11 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
12 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
13 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
14 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
17 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
29 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
30 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
31 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
32 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
33 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
34 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
35 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
38 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
39 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
40 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
41 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
42 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
43 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
44 2820023741 Unclassified Spirochaetes Lab288P3bin165 Isolate Unclassified
45 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
46 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
47 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
48 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
49 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
50 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
51 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
52 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
53 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
54 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
55 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
56 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
57 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
58 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
59 2820021908 Unclassified Spirochaetes Lab288P4bin6 Isolate Unclassified
60 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
61 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
62 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
63 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
64 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
65 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
66 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
67 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
68 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
69 650716102 Treponema primitia ZAS-2 Isolate Unclassified
70 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
71 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
72 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
73 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
74 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
75 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
76 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
77 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
78 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
79 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
80 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
81 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
82 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
83 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
84 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
85 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
86 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
87 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
88 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_083281 3300042656 Unclassified 1555
2 Ga0466732_292918 3300042656 Unclassified 1000
3 Ga0466732_361035 3300042656 Bacteria 3093
4 Ga0466692_094700 3300042591 Bacteria 5008
5 Ga0466694_117054 3300042594 Bacteria 29455
6 Ga0466694_133903 3300042594 Bacteria 4164
7 Ga0466696_074354 3300042596 Bacteria 15993
8 Ga0466696_198773 3300042596 Bacteria 6245
9 Ga0466707_205249 3300042601 Bacteria 2584
10 Ga0466722_149820 3300042609 Bacteria 2029
11 Ga0123355_11994440 3300009826 Bacteria 538
12 Ga0123356_10557320 3300010049 Bacteria 1308
13 Ga0123356_12405675 3300010049 Unclassified 659
14 Ga0123356_13310251 3300010049 Unclassified 560
15 Ga0123353_10015173 3300010167 Bacteria 11171
16 Ga0123353_12914044 3300010167 Unclassified 557
17 FAAS_10804241 3300001880 Unclassified 508
18 JGI24698J34947_10054538 3300002449 Unclassified 1995
19 JGI24698J34947_10315365 3300002449 Bacteria 558
20 JGI24695J34938_10001073 3300002450 Bacteria 24681
21 JGI24695J34938_10001911 3300002450 Bacteria 16835
22 JGI24695J34938_10003590 3300002450 Bacteria 10673
23 JGI24695J34938_10004999 3300002450 Bacteria 8445
24 JGI24695J34938_10583932 3300002450 Unclassified 519
25 JGI24702J35022_10155542 3300002462 Unclassified 1285
26 JGI24696J40584_12910503 3300002834 Unclassified 1252
27 Ga0466731_025412 3300042622 Bacteria 1920
28 Ga0466735_106820 3300042624 Bacteria 10957
29 Ga0466704_462799 3300042643 Unclassified 3567
30 Ga0466708_202436 3300042652 Unclassified 4481
31 Ga0466711_033930 3300042615 Bacteria 2090
32 Ga0466715_015645 3300042616 Bacteria 22521
33 Ga0466715_115211 3300042616 Bacteria 2163
34 Ga0466718_003503 3300042617 Bacteria 6870
35 Ga0466718_020000 3300042617 Unclassified 3197
36 Ga0466723_246860 3300042618 Bacteria 1579
37 Ga0466728_036575 3300042620 Bacteria 2505
38 Ga0255786_1005183 3300022815 Bacteria 521
39 Ga0264413_120022 3300024493 Bacteria 1763
40 Ga0466690_080408 3300042590 Bacteria 2903
41 Ga0466693_006037 3300042592 Bacteria 1788
42 Ga0466691_054990 3300042593 Bacteria 8155
43 Ga0466691_138959 3300042593 Bacteria 1527
44 Ga0466694_097189 3300042594 Bacteria 4068
45 Ga0466694_175712 3300042594 Bacteria 3185
46 Ga0466699_310609 3300042597 Bacteria 1524
47 Ga0466722_007214 3300042609 Bacteria 6600
48 Ga0123355_10040034 3300009826 Bacteria 7629
49 Ga0123356_10000046 3300010049 Bacteria 130593
50 Ga0123356_10137407 3300010049 Bacteria 2405
51 Ga0123353_10705017 3300010167 Unclassified 1415
52 Ga0123353_11072717 3300010167 Unclassified 1073
53 AustNasuHG_c1079472 3300000089 Unclassified 559
54 JGI24695J34938_10002092 3300002450 Bacteria 15650
55 JGI24695J34938_10002490 3300002450 Bacteria 14041
56 JGI24695J34938_10003663 3300002450 Bacteria 10530
57 JGI24695J34938_10005223 3300002450 Bacteria 8194
58 JGI24695J34938_10038441 3300002450 Bacteria 2168
59 JGI24695J34938_10071921 3300002450 Unclassified 1444
60 JGI24702J35022_10187034 3300002462 Unclassified 1180
61 Ga0466705_078763 3300042612 Bacteria 55629
62 Ga0466705_206560 3300042612 Bacteria 5661
63 Ga0466703_097389 3300042636 Bacteria 65902
64 Ga0466704_205769 3300042643 Bacteria 8884
65 Ga0466712_100729 3300042614 Bacteria 39851
66 Ga0466711_029143 3300042615 Bacteria 18927
67 Ga0466715_234347 3300042616 Bacteria 7205
68 Ga0466718_066324 3300042617 Bacteria 1474
69 Ga0466718_072376 3300042617 Bacteria 10012
70 Ga0466732_031643 3300042656 Bacteria 29390
71 Ga0415639_000652 3300038395 Bacteria 7186
72 Ga0466691_128218 3300042593 Bacteria 1756
73 Ga0466694_174349 3300042594 Bacteria 93398
74 Ga0466694_355797 3300042594 Bacteria 1581
75 Ga0466696_196768 3300042596 Bacteria 2585
76 Ga0466699_145613 3300042597 Bacteria 1056
77 Ga0466699_171342 3300042597 Bacteria 1612
78 Ga0466720_132124 3300042607 Bacteria 4218
79 Ga0123353_11324364 3300010167 Bacteria 933
80 JGI24695J34938_10112311 3300002450 Unclassified 1110
81 JGI24695J34938_10310415 3300002450 Bacteria 684
82 JGI24695J34938_10603714 3300002450 Unclassified 511
83 JGI24705J35276_11354146 3300002504 Bacteria 515
84 JGI24705J35276_12191408 3300002504 Bacteria 1474
85 Ga0466709_149267 3300042648 Bacteria 13000
86 Ga0466709_156650 3300042648 Unclassified 2251
87 Ga0466709_347160 3300042648 Bacteria 1851
88 Ga0466708_411386 3300042652 Unclassified 2757
89 Ga0466711_133365 3300042615 Bacteria 16038
90 Ga0466715_075578 3300042616 Bacteria 13118
91 Ga0466718_120431 3300042617 Bacteria 4934
92 Ga0466718_135236 3300042617 Bacteria 5160
93 Ga0466723_018194 3300042618 Bacteria 1585
94 Ga0466726_026909 3300042619 Bacteria 7041
95 Ga0466726_375795 3300042619 Unclassified 1876
96 Ga0466728_335928 3300042620 Bacteria 8489
97 Ga0466728_398333 3300042620 Bacteria 4079
98 Ga0466732_274925 3300042656 Bacteria 3086
99 Ga0264413_102031 3300024493 Bacteria 23746
100 Ga0466693_141209 3300042592 Bacteria 12935
101 Ga0466695_199027 3300042595 Bacteria 1256
102 Ga0466696_245651 3300042596 Bacteria 1896
103 Ga0466696_332738 3300042596 Bacteria 1839
104 Ga0466696_340442 3300042596 Bacteria 7495
105 Ga0466717_036281 3300042604 Bacteria 2215
106 Ga0466716_007685 3300042605 Bacteria 4350
107 Ga0123355_11855196 3300009826 Bacteria 566
108 Ga0123356_11774620 3300010049 Unclassified 767
109 Ga0123356_12411378 3300010049 Unclassified 658
110 Ga0123356_12444943 3300010049 Unclassified 654
111 Ga0123353_10475677 3300010167 Bacteria 1830
112 Ga0123353_11382525 3300010167 Bacteria 907
113 Ga0123354_10080508 3300010882 Bacteria 4610
114 JGI24698J34947_10203532 3300002449 Unclassified 773
115 JGI24695J34938_10000790 3300002450 Bacteria 29511
116 Ga0072941_1032758 3300005201 Bacteria 9046
117 Ga0466705_496178 3300042612 Bacteria 2390
118 Ga0466712_182075 3300042614 Bacteria 5838
119 Ga0466715_198808 3300042616 Bacteria 3080
120 Ga0466728_054758 3300042620 Bacteria 12639
121 Ga0466728_114938 3300042620 Bacteria 5829
122 Ga0466728_332009 3300042620 Unclassified 1084
123 Ga0415639_047435 3300038395 Bacteria 1477
124 Ga0466690_164024 3300042590 Bacteria 9904
125 Ga0466690_270221 3300042590 Bacteria 3462
126 Ga0466694_071387 3300042594 Bacteria 17151
127 Ga0466696_178164 3300042596 Bacteria 1654
128 Ga0466699_002532 3300042597 Bacteria 37404
129 Ga0466699_121994 3300042597 Unclassified 4690
130 Ga0466706_128720 3300042599 Bacteria 33388
131 Ga0466713_140910 3300042602 Bacteria 3928
132 Ga0466716_383219 3300042605 Bacteria 3074
133 Ga0466716_416187 3300042605 Bacteria 4717
134 Ga0466719_157108 3300042606 Unclassified 1611
135 Ga0466719_163146 3300042606 Bacteria 5228
136 Ga0466720_027801 3300042607 Unclassified 1438
137 Ga0466720_045235 3300042607 Unclassified 1330
138 Ga0466720_097240 3300042607 Bacteria 3000
139 Ga0466720_184952 3300042607 Bacteria 2132
140 Ga0123356_10000195 3300010049 Bacteria 69819
141 Ga0123356_10045831 3300010049 Bacteria 4068
142 Ga0123353_10302491 3300010167 Bacteria 2440
143 FAAS_10343875 3300001880 Unclassified 532
144 JGI24698J34947_10092565 3300002449 Unclassified 1382
145 JGI24695J34938_10004096 3300002450 Bacteria 9722
146 JGI24695J34938_10033356 3300002450 Bacteria 2369
147 JGI24695J34938_10066064 3300002450 Unclassified 1525
148 Ga0072940_1101999 3300005200 Unclassified 716
149 Ga0072941_1009709 3300005201 Bacteria 5750
150 Ga0466735_034663 3300042624 Bacteria 1627
151 Ga0466702_039283 3300042635 Unclassified 1449
152 Ga0466703_083527 3300042636 Bacteria 18804
153 Ga0466703_210502 3300042636 Bacteria 13555
154 Ga0466709_387946 3300042648 Unclassified 1631
155 Ga0466708_112603 3300042652 Bacteria 18701
156 Ga0466727_161381 3300042655 Bacteria 6286
157 Ga0466712_023839 3300042614 Bacteria 59773
158 Ga0466712_275374 3300042614 Bacteria 3942
159 Ga0466711_340692 3300042615 Bacteria 2006
160 Ga0466715_095903 3300042616 Bacteria 49538
161 Ga0466718_072460 3300042617 Bacteria 3590
162 Ga0466726_015446 3300042619 Bacteria 2611
163 Ga0466726_069730 3300042619 Bacteria 15793
164 Ga0466691_128423 3300042593 Bacteria 7008
165 Ga0466694_102222 3300042594 Bacteria 1526
166 Ga0466694_406512 3300042594 Unclassified 1065
167 Ga0466696_194696 3300042596 Bacteria 1810
168 Ga0466707_060612 3300042601 Bacteria 6168
169 Ga0466716_284223 3300042605 Bacteria 20573
170 Ga0123356_10031490 3300010049 Bacteria 4963
171 Ga0123356_10464603 3300010049 Bacteria 1416
172 Nasutiter_FTJKGMZ01AWUVW 2030936001 Bacteria 528
173 JGI24698J34947_10216212 3300002449 Bacteria 739
174 JGI24695J34938_10001642 3300002450 Bacteria 18624
175 JGI24695J34938_10002946 3300002450 Bacteria 12310
176 JGI24695J34938_10049940 3300002450 Unclassified 1837
177 Ga0068305_10042865 3300005083 Bacteria 19633
178 Ga0072941_1000900 3300005201 Bacteria 3782
179 Ga0466704_031855 3300042643 Bacteria 22665
180 Ga0466704_240823 3300042643 Bacteria 65386
181 Ga0466708_160257 3300042652 Unclassified 1557
182 Ga0466725_460336 3300042654 Bacteria 1103
183 Ga0466718_040010 3300042617 Bacteria 19606
184 Ga0466723_153713 3300042618 Bacteria 1724
185 Ga0466726_092915 3300042619 Bacteria 3771
186 Ga0466726_275870 3300042619 Bacteria 4221
187 Ga0466728_004290 3300042620 Bacteria 5219
188 Ga0466728_214169 3300042620 Bacteria 1020
189 Ga0466729_014573 3300042621 Bacteria 1472
190 Ga0466732_208863 3300042656 Unclassified 1789
191 Ga0415639_061174 3300038395 Bacteria 1297
192 Ga0466690_340814 3300042590 Bacteria 8855
193 Ga0466692_161583 3300042591 Bacteria 2404
194 Ga0466692_180132 3300042591 Bacteria 6899
195 Ga0466691_032311 3300042593 Bacteria 18403
196 Ga0466691_144178 3300042593 Bacteria 16296
197 Ga0466696_370474 3300042596 Unclassified 1744
198 Ga0466699_210058 3300042597 Bacteria 3431
199 Ga0466699_334053 3300042597 Bacteria 4211
200 Ga0466707_191887 3300042601 Bacteria 1206
201 Ga0466707_324861 3300042601 Unclassified 1536
202 Ga0466707_331320 3300042601 Bacteria 1084
203 Ga0466719_256530 3300042606 Bacteria 17913
204 Ga0466720_016876 3300042607 Bacteria 1723
205 Ga0466722_001172 3300042609 Bacteria 18968
206 Ga0466698_271400 3300042610 Bacteria 1687
207 Ga0466698_453430 3300042610 Bacteria 1655
208 Ga0123357_10217591 3300009784 Bacteria 2128
209 Ga0123357_10455714 3300009784 Bacteria 1105
210 Ga0123356_10229441 3300010049 Bacteria 1920
211 Ga0123356_10407241 3300010049 Bacteria 1499
212 Ga0123356_10643291 3300010049 Bacteria 1227
213 Ga0123353_10163080 3300010167 Unclassified 3546
214 JGI24698J34947_10000266 3300002449 Bacteria 22368
215 JGI24698J34947_10131499 3300002449 Bacteria 1069
216 JGI24698J34947_10165555 3300002449 Unclassified 901
217 JGI24695J34938_10003330 3300002450 Bacteria 11311
218 JGI24695J34938_10008298 3300002450 Bacteria 5938
219 JGI24695J34938_10018661 3300002450 Bacteria 3460
220 JGI24695J34938_10613252 3300002450 Bacteria 508
221 JGI24702J35022_10003691 3300002462 Bacteria 9212
222 JGI24705J35276_11700112 3300002504 Unclassified 633
223 JGI24699J35502_10682712 3300002509 Unclassified 749
224 Ga0466704_149580 3300042643 Bacteria 17340
225 Ga0466708_162571 3300042652 Bacteria 8159
226 Ga0466712_048121 3300042614 Bacteria 9792
227 Ga0466718_078064 3300042617 Bacteria 2652
228 Ga0466733_071046 3300042659 Bacteria 1057
229 Ga0466690_143748 3300042590 Unclassified 2750
230 Ga0466691_171775 3300042593 Bacteria 14094
231 Ga0466696_019612 3300042596 Bacteria 8245
232 Ga0466700_061995 3300042600 Bacteria 1397
233 Ga0466717_121579 3300042604 Bacteria 1020
234 Ga0466716_430551 3300042605 Bacteria 3096
235 Ga0466719_121591 3300042606 Bacteria 15112
236 Ga0466720_040340 3300042607 Bacteria 7320
237 Ga0466720_092810 3300042607 Unclassified 4408
238 Ga0123356_10088676 3300010049 Bacteria 2941
239 Ga0123356_10169925 3300010049 Unclassified 2190
240 Ga0123353_10011270 3300010167 Unclassified 12581
241 Ga0123353_12163488 3300010167 Bacteria 674
242 AustNasuHG_c1000067 3300000089 Bacteria 28563
243 AustNasuHG_c1003903 3300000089 Bacteria 5368
244 AustNasuHG_c1006635 3300000089 Bacteria 4123
245 FAAS_10798280 3300001880 Unclassified 548
246 JGI24698J34947_10002376 3300002449 Bacteria 10134
247 JGI24698J34947_10004025 3300002449 Bacteria 7991
248 JGI24698J34947_10079789 3300002449 Unclassified 1540
249 JGI24695J34938_10001722 3300002450 Bacteria 18091
250 JGI24695J34938_10002816 3300002450 Bacteria 12700
251 JGI24695J34938_10057695 3300002450 Unclassified 1667
252 JGI24695J34938_10346066 3300002450 Unclassified 652
253 JGI24702J35022_10047695 3300002462 Bacteria 2280
254 JGI24702J35022_10683509 3300002462 Bacteria 637
255 JGI24699J35502_11094682 3300002509 Bacteria 2209
256 Ga0068305_10053978 3300005083 Bacteria 2290
257 Ga0466712_004974 3300042614 Unclassified 3021
258 Ga0466718_015932 3300042617 Bacteria 2640
259 Ga0466718_082761 3300042617 Bacteria 3298
260 Ga0466723_078201 3300042618 Bacteria 3706
261 Ga0466728_366596 3300042620 Unclassified 1459

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00471 Ribosomal_L33 Ribosomal protein L33 23 68 0.98

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.