Protein Family IF07872
Metagenome
Isolate
124
Members
62
Samples
119
Scaffolds
336.27
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_014550|Ga0466718_014550_765_1922
- Length
- 385 aa
- Sequence
- MAYRKCGTKNNYGKQAMTKSEFEHILEKACSVLTTEARNNGFSSSMQFEKRVREILCDLFPDNFNCQGIPIVSVYHIRNYLIPYMINQSLRSITQSYPEIKIDFNPHPQAFPDIAVGNFGVEVKFTLNDTWRSVANSILETNRIDTVEKVYLIFGKMGGTPEVKWGDYEKSVIHVRTSHVPRFEVEISADRSLFEMMGISYDDFRKLKMEEKMHYIRTYARSRLQKGERLWWLEDNIEAEHAIPIQARLYTNLPTEEKTKLRAEVVLLLLSIVKSGRAKNKYDDAVLYLLTYHGVICHQARDLFSVGSVANPENDDEGGIYIERALKIIEKEIIQASLTMDDALFVEYWGESVPPEQRIKKWLEKADALAQGWIPSKSLFLQERQ
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.7%
Kalotermitidae
21.7%
Formicidae
13.3%
Unclassified
8.3%
Rhinotermitidae
6.7%
Termopsidae
5.0%
Nephropidae
1.7%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 13 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 26 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 31 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 32 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 33 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 34 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 37 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 38 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 39 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 44 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 45 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 46 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 47 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 48 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 51 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 52 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 53 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 54 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 55 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 56 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 57 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 58 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 61 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 62 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10117340 | 3300010049 | Bacteria | 2582 |
| 2 | AustNasuHG_c1012868 | 3300000089 | Bacteria | 2880 |
| 3 | JGI24700J35501_10873849 | 3300002508 | Unclassified | 2302 |
| 4 | Ga0072941_1006378 | 3300005201 | Bacteria | 8708 |
| 5 | Ga0466690_008278 | 3300042590 | Bacteria | 1123 |
| 6 | Ga0466690_081356 | 3300042590 | Bacteria | 4506 |
| 7 | Ga0466694_070846 | 3300042594 | Bacteria | 4911 |
| 8 | Ga0466696_081539 | 3300042596 | Bacteria | 3292 |
| 9 | Ga0466713_041964 | 3300042602 | Bacteria | 2680 |
| 10 | Ga0466714_167342 | 3300042603 | Bacteria | 2238 |
| 11 | Ga0466722_083996 | 3300042609 | Unclassified | 5367 |
| 12 | Ga0466729_291594 | 3300042621 | Bacteria | 1518 |
| 13 | Ga0466727_280344 | 3300042655 | Bacteria | 3613 |
| 14 | Ga0466705_254529 | 3300042612 | Bacteria | 22062 |
| 15 | Ga0123357_10012462 | 3300009784 | Bacteria | 10972 |
| 16 | Ga0123357_10131887 | 3300009784 | Bacteria | 3107 |
| 17 | Ga0123355_10182932 | 3300009826 | Bacteria | 3107 |
| 18 | Ga0123353_10341338 | 3300010167 | Bacteria | 2262 |
| 19 | AustNasuHG_c1001767 | 3300000089 | Bacteria | 7827 |
| 20 | Ga0102740_1000220 | 3300007140 | Bacteria | 16312 |
| 21 | Ga0102737_1000156 | 3300007142 | Bacteria | 22482 |
| 22 | Ga0466723_165711 | 3300042618 | Bacteria | 3122 |
| 23 | Ga0466726_489222 | 3300042619 | Bacteria | 4481 |
| 24 | Ga0466728_457296 | 3300042620 | Bacteria | 126268 |
| 25 | Ga0466707_265273 | 3300042601 | Bacteria | 3670 |
| 26 | Ga0466707_415474 | 3300042601 | Bacteria | 53777 |
| 27 | Ga0466722_176515 | 3300042609 | Bacteria | 3014 |
| 28 | Ga0466722_236936 | 3300042609 | Bacteria | 5071 |
| 29 | Ga0466702_138063 | 3300042635 | Unclassified | 2373 |
| 30 | Ga0466703_018777 | 3300042636 | Bacteria | 2385 |
| 31 | Ga0466703_421728 | 3300042636 | Bacteria | 9037 |
| 32 | Ga0466709_048838 | 3300042648 | Bacteria | 1797 |
| 33 | Ga0102734_1004085 | 3300007129 | Bacteria | 3285 |
| 34 | Ga0264413_112916 | 3300024493 | Bacteria | 26433 |
| 35 | Ga0415639_090243 | 3300038395 | Bacteria | 1934 |
| 36 | Ga0466657_140578 | 3300042582 | Bacteria | 4530 |
| 37 | Ga0466692_180925 | 3300042591 | Unclassified | 6564 |
| 38 | Ga0466691_044202 | 3300042593 | Unclassified | 7039 |
| 39 | Ga0466691_110516 | 3300042593 | Unclassified | 1027 |
| 40 | Ga0466699_136222 | 3300042597 | Bacteria | 2018 |
| 41 | Ga0466710_108093 | 3300042613 | Bacteria | 2217 |
| 42 | Ga0466706_115479 | 3300042599 | Bacteria | 6773 |
| 43 | Ga0466721_061458 | 3300042608 | Unclassified | 1558 |
| 44 | Ga0466722_032232 | 3300042609 | Bacteria | 5576 |
| 45 | Ga0466704_050458 | 3300042643 | Bacteria | 2649 |
| 46 | Ga0466709_191673 | 3300042648 | Bacteria | 7557 |
| 47 | Ga0466708_024943 | 3300042652 | Bacteria | 6887 |
| 48 | Ga0466725_253007 | 3300042654 | Bacteria | 25183 |
| 49 | Ga0123353_10114302 | 3300010167 | Bacteria | 4346 |
| 50 | JGI24698J34947_10035228 | 3300002449 | Unclassified | 2614 |
| 51 | Ga0072941_1560969 | 3300005201 | Bacteria | 1492 |
| 52 | Ga0466690_010388 | 3300042590 | Unclassified | 1498 |
| 53 | Ga0466693_319175 | 3300042592 | Bacteria | 2579 |
| 54 | Ga0466694_324698 | 3300042594 | Bacteria | 1662 |
| 55 | Ga0466715_640076 | 3300042616 | Bacteria | 2551 |
| 56 | Ga0466718_011310 | 3300042617 | Bacteria | 2853 |
| 57 | Ga0466701_089930 | 3300042598 | Bacteria | 2839 |
| 58 | Ga0466727_329742 | 3300042655 | Bacteria | 2228 |
| 59 | Ga0466705_149061 | 3300042612 | Bacteria | 7574 |
| 60 | Ga0466705_301155 | 3300042612 | Bacteria | 1555 |
| 61 | Ga0123356_10234116 | 3300010049 | Bacteria | 1903 |
| 62 | Ga0123353_10160414 | 3300010167 | Bacteria | 3581 |
| 63 | Ga0123353_10197907 | 3300010167 | Bacteria | 3165 |
| 64 | JGI24698J34947_10004541 | 3300002449 | Bacteria | 7559 |
| 65 | Ga0072941_1030675 | 3300005201 | Bacteria | 6629 |
| 66 | Ga0466690_373499 | 3300042590 | Bacteria | 1988 |
| 67 | Ga0466705_504032 | 3300042612 | Bacteria | 1815 |
| 68 | Ga0466712_038540 | 3300042614 | Bacteria | 38834 |
| 69 | Ga0466718_014550 | 3300042617 | Unclassified | 3101 |
| 70 | Ga0466707_308875 | 3300042601 | Bacteria | 6058 |
| 71 | Ga0466735_153649 | 3300042624 | Bacteria | 3202 |
| 72 | Ga0466727_048078 | 3300042655 | Bacteria | 2123 |
| 73 | Ga0466705_308304 | 3300042612 | Bacteria | 11967 |
| 74 | Ga0466732_438973 | 3300042656 | Bacteria | 2485 |
| 75 | Ga0123356_10254188 | 3300010049 | Bacteria | 1837 |
| 76 | Ga0123353_10763317 | 3300010167 | Bacteria | 1343 |
| 77 | JGI24698J34947_10041294 | 3300002449 | Bacteria | 2376 |
| 78 | Ga0102735_1003170 | 3300007080 | Bacteria | 2353 |
| 79 | Ga0102738_1000129 | 3300007141 | Bacteria | 21681 |
| 80 | Ga0466691_056063 | 3300042593 | Bacteria | 20184 |
| 81 | Ga0466712_044532 | 3300042614 | Bacteria | 1946 |
| 82 | Ga0466729_012451 | 3300042621 | Unclassified | 2776 |
| 83 | Ga0466719_283000 | 3300042606 | Bacteria | 2484 |
| 84 | Ga0466722_046080 | 3300042609 | Bacteria | 4070 |
| 85 | Ga0466731_217698 | 3300042622 | Bacteria | 1459 |
| 86 | Ga0123356_10623327 | 3300010049 | Bacteria | 1244 |
| 87 | AustNasuHG_c1016144 | 3300000089 | Unclassified | 2504 |
| 88 | AustNasuHG_c1028908 | 3300000089 | Unclassified | 1641 |
| 89 | Ga0072940_1012591 | 3300005200 | Bacteria | 1462 |
| 90 | Ga0072941_1007066 | 3300005201 | Unclassified | 1687 |
| 91 | Ga0103261_1002288 | 3300007083 | Bacteria | 3003 |
| 92 | Ga0264413_113044 | 3300024493 | Unclassified | 3665 |
| 93 | Ga0466690_107145 | 3300042590 | Bacteria | 23763 |
| 94 | Ga0466691_177393 | 3300042593 | Bacteria | 7611 |
| 95 | Ga0466696_122385 | 3300042596 | Bacteria | 3473 |
| 96 | Ga0466696_217850 | 3300042596 | Bacteria | 2569 |
| 97 | Ga0466711_104763 | 3300042615 | Bacteria | 4168 |
| 98 | Ga0466723_078022 | 3300042618 | Bacteria | 6033 |
| 99 | Ga0466728_328390 | 3300042620 | Bacteria | 3520 |
| 100 | Ga0466729_113188 | 3300042621 | Unclassified | 1878 |
| 101 | Ga0466706_218324 | 3300042599 | Bacteria | 1383 |
| 102 | Ga0466719_066066 | 3300042606 | Bacteria | 8606 |
| 103 | Ga0466719_393210 | 3300042606 | Bacteria | 2840 |
| 104 | Ga0466703_202542 | 3300042636 | Bacteria | 4492 |
| 105 | Ga0072941_1007400 | 3300005201 | Bacteria | 25884 |
| 106 | Ga0072941_1153141 | 3300005201 | Bacteria | 2363 |
| 107 | Ga0102736_1002177 | 3300007052 | Bacteria | 3173 |
| 108 | Ga0102735_1000614 | 3300007080 | Bacteria | 9668 |
| 109 | Ga0456237_0014623 | 3300041968 | Unclassified | 1117 |
| 110 | Ga0466711_021198 | 3300042615 | Bacteria | 12678 |
| 111 | Ga0466706_032295 | 3300042599 | Bacteria | 17057 |
| 112 | Ga0466707_244954 | 3300042601 | Bacteria | 14044 |
| 113 | Ga0466720_005558 | 3300042607 | Bacteria | 6995 |
| 114 | Ga0466721_154194 | 3300042608 | Bacteria | 46975 |
| 115 | Ga0466697_041035 | 3300042611 | Unclassified | 1256 |
| 116 | Ga0466703_072996 | 3300042636 | Bacteria | 3940 |
| 117 | Ga0466703_388245 | 3300042636 | Bacteria | 2668 |
| 118 | Ga0466704_106973 | 3300042643 | Bacteria | 3348 |
| 119 | Ga0466704_521977 | 3300042643 | Bacteria | 4356 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.