Protein Family IF07860

Metagenome
115 Members
38 Samples
115 Scaffolds
397.63 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_001140|Ga0466718_001140_477_1718
Length
413 aa
Sequence
VKRYTAKEASMAITKEVLDELLREYKGPDDFYGPEGIMKQLSKALIERAMQAELTEQIGYEKSESGEKPNGNRRNGKSSKTLRTDQGPMEIAVPRDRDGNFEPRIIGKHQREWRGFDDKILAMYSHGMSTQGIQATIKDIYNVDISPELVSRVTDEVKGMVDEWRNRPLEAFYPVVFFDVLRVNIRDEGHVSKKAVYLALAIRIDGQKELLGMWIEKNEGSKFWTGILNELKNRGVKDILLAAVDGLSGFPDAVNAVFSKTEVQLCIVHMVRNSVKYVPYKDRKAVTADLKEIYLAPSEDAAGDALENFAEKWDRKYPAISKSWRNRWMEIIPYMKFSPEIRKAVYTTNAIESVNYTLQRNLKTRQSFPNDEAAMKLIYMVLQRISKRWTMPIRNWGEALHQFSLIYGDRVPL

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 89.2%
Kalotermitidae 5.4%
Termopsidae 5.4%

🌳 Taxonomy

Archaea 0
Bacteria 103
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
2 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
3 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
4 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
5 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
6 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
7 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
8 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
9 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
10 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
11 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
12 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
13 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
14 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
15 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
16 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
17 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
18 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
19 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
20 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
21 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
22 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
23 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
24 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
27 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
28 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
35 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
36 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
37 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
38 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466718_034012 3300042617 Bacteria 1459
2 Ga0466657_201459 3300042582 Bacteria 1451
3 Ga0466699_099710 3300042597 Bacteria 1572
4 Ga0466731_127324 3300042622 Bacteria 1469
5 Ga0466735_050896 3300042624 Bacteria 2197
6 Ga0466702_464579 3300042635 Bacteria 1748
7 Ga0466704_080664 3300042643 Bacteria 4198
8 Ga0466727_237603 3300042655 Bacteria 1583
9 Ga0466701_067920 3300042598 Bacteria 4194
10 Ga0466700_327485 3300042600 Bacteria 1567
11 Ga0466717_106792 3300042604 Bacteria 1561
12 Ga0466720_020302 3300042607 Bacteria 18271
13 Ga0466721_060938 3300042608 Unclassified 2059
14 Ga0123357_10255464 3300009784 Bacteria 1864
15 Ga0123357_10257477 3300009784 Bacteria 1852
16 Ga0123355_10437824 3300009826 Bacteria 1658
17 Ga0123356_10462687 3300010049 Bacteria 1418
18 Ga0466733_013658 3300042659 Bacteria 32528
19 Ga0466710_103338 3300042613 Bacteria 1532
20 Ga0466710_286114 3300042613 Bacteria 1444
21 Ga0466710_327534 3300042613 Bacteria 1469
22 Ga0466712_037176 3300042614 Bacteria 5377
23 Ga0466718_028803 3300042617 Bacteria 1584
24 Ga0466699_251267 3300042597 Bacteria 2342
25 Ga0466731_080436 3300042622 Bacteria 2023
26 Ga0466702_292566 3300042635 Bacteria 2997
27 Ga0466701_026195 3300042598 Bacteria 2047
28 Ga0466701_051058 3300042598 Bacteria 4613
29 Ga0466720_012628 3300042607 Bacteria 4465
30 Ga0466720_131747 3300042607 Unclassified 2074
31 Ga0466721_294841 3300042608 Bacteria 2505
32 Ga0123355_10490168 3300009826 Bacteria 1523
33 Ga0123356_10239984 3300010049 Unclassified 1883
34 Ga0123353_10141166 3300010167 Bacteria 3858
35 Ga0466732_345396 3300042656 Bacteria 1837
36 Ga0466733_122469 3300042659 Bacteria 3596
37 Ga0466712_144890 3300042614 Unclassified 1674
38 Ga0466718_000599 3300042617 Bacteria 1486
39 Ga0264413_102186 3300024493 Bacteria 1469
40 Ga0466699_195560 3300042597 Unclassified 1283
41 Ga0466734_005448 3300042623 Bacteria 1346
42 Ga0466702_320064 3300042635 Bacteria 2424
43 Ga0466717_052321 3300042604 Bacteria 1770
44 Ga0466698_200947 3300042610 Bacteria 1838
45 AustNasuHG_c1004897 3300000089 Bacteria 4797
46 JGI24698J34947_10048882 3300002449 Bacteria 2140
47 JGI24702J35022_10130966 3300002462 Bacteria 1392
48 Ga0466705_223408 3300042612 Bacteria 3239
49 Ga0466710_053130 3300042613 Unclassified 1323
50 Ga0466712_188083 3300042614 Unclassified 1296
51 Ga0466718_001140 3300042617 Bacteria 2275
52 Ga0466693_056649 3300042592 Bacteria 1475
53 Ga0466693_230814 3300042592 Bacteria 1404
54 Ga0466695_097484 3300042595 Bacteria 1823
55 Ga0466731_291010 3300042622 Bacteria 1708
56 Ga0466734_144999 3300042623 Bacteria 1352
57 Ga0466727_279836 3300042655 Bacteria 1480
58 Ga0466701_026201 3300042598 Bacteria 1651
59 Ga0466700_413563 3300042600 Unclassified 1450
60 Ga0466717_289709 3300042604 Bacteria 1761
61 Ga0123356_10074053 3300010049 Bacteria 3204
62 Ga0123356_10253906 3300010049 Bacteria 1838
63 Ga0123353_10580524 3300010167 Bacteria 1608
64 JGI24698J34947_10093542 3300002449 Bacteria 1372
65 JGI24695J34938_10083216 3300002450 Bacteria 1320
66 JGI24702J35022_10124913 3300002462 Bacteria 1424
67 Ga0466694_015934 3300042594 Bacteria 3145
68 Ga0466695_342048 3300042595 Bacteria 1534
69 Ga0466727_178245 3300042655 Bacteria 1577
70 Ga0466701_024538 3300042598 Bacteria 1979
71 Ga0466701_093023 3300042598 Bacteria 2864
72 Ga0466700_160533 3300042600 Bacteria 1718
73 Ga0466717_186650 3300042604 Bacteria 1507
74 Ga0123356_10373893 3300010049 Bacteria 1556
75 Ga0123356_10565261 3300010049 Bacteria 1299
76 Ga0074263_110016 3300005485 Bacteria 2217
77 Ga0466712_067302 3300042614 Unclassified 3408
78 Ga0466657_281849 3300042582 Bacteria 1469
79 Ga0466695_052245 3300042595 Bacteria 2968
80 Ga0466695_164252 3300042595 Bacteria 1454
81 Ga0466699_199978 3300042597 Bacteria 1514
82 Ga0466731_063476 3300042622 Bacteria 1627
83 Ga0466731_091526 3300042622 Bacteria 1464
84 Ga0466734_161905 3300042623 Bacteria 1583
85 Ga0466730_071113 3300042625 Bacteria 2013
86 Ga0466724_02892 3300042649 Bacteria 2427
87 Ga0466727_327802 3300042655 Bacteria 1835
88 Ga0466717_132902 3300042604 Bacteria 1439
89 Ga0466720_102242 3300042607 Unclassified 5227
90 Ga0466720_137009 3300042607 Bacteria 1460
91 Ga0466698_161378 3300042610 Bacteria 1735
92 Ga0123353_10604981 3300010167 Bacteria 1565
93 AustNasuHG_c1031205 3300000089 Bacteria 1512
94 AustNasuHG_c1034342 3300000089 Bacteria 1359
95 JGI24698J34947_10048024 3300002449 Bacteria 2164
96 JGI24695J34938_10070326 3300002450 Bacteria 1465
97 JGI24705J35276_12171691 3300002504 Bacteria 1298
98 Ga0466733_026948 3300042659 Bacteria 1862
99 Ga0466718_097294 3300042617 Unclassified 1712
100 Ga0466656_098681 3300042550 Bacteria 1578
101 Ga0466695_268924 3300042595 Bacteria 1465
102 Ga0466700_004350 3300042600 Bacteria 1228
103 Ga0466721_399346 3300042608 Bacteria 1418
104 Ga0123356_10565262 3300010049 Unclassified 1299
105 JGI24698J34947_10051330 3300002449 Bacteria 2074
106 Ga0466693_018703 3300042592 Bacteria 1411
107 Ga0466693_220554 3300042592 Bacteria 1519
108 Ga0466694_253201 3300042594 Bacteria 1519
109 Ga0466699_388375 3300042597 Bacteria 1643
110 Ga0466717_004357 3300042604 Bacteria 1559
111 Ga0466720_005612 3300042607 Bacteria 4076
112 Ga0466721_249486 3300042608 Bacteria 1444
113 Ga0123356_10379238 3300010049 Bacteria 1546
114 Ga0123353_10333468 3300010167 Bacteria 2295
115 JGI24699J35502_11003614 3300002509 Bacteria 1364

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10490168 Ga0123355_104901681 332
2 3300042635 Ga0466702_320064 Ga0466702_320064_1178_2191 337
3 3300042600 Ga0466700_004350 Ga0466700_004350_129_1154 341
4 3300042613 Ga0466710_053130 Ga0466710_053130_184_1248 354
5 3300042582 Ga0466657_201459 Ga0466657_201459_158_1336 361
6 3300042592 Ga0466693_220554 Ga0466693_220554_305_1399 364
7 3300042608 Ga0466721_399346 Ga0466721_399346_27_1121 364
8 3300042624 Ga0466735_050896 Ga0466735_050896_220_1314 364
9 3300042623 Ga0466734_005448 Ga0466734_005448_57_1187 376
10 3300042623 Ga0466734_144999 Ga0466734_144999_134_1270 378
11 3300042655 Ga0466727_237603 Ga0466727_237603_291_1430 379
12 3300042594 Ga0466694_015934 Ga0466694_015934_1325_2473 382
13 3300002449 JGI24698J34947_10051330 JGI24698J34947_100513303 387
14 3300010049 Ga0123356_10462687 Ga0123356_104626871 387
15 3300010049 Ga0123356_10565261 Ga0123356_105652611 388
16 3300010049 Ga0123356_10565262 Ga0123356_105652621 388
17 3300042659 Ga0466733_122469 Ga0466733_122469_1171_2382 388
18 3300042592 Ga0466693_056649 Ga0466693_056649_122_1333 389
19 3300010049 Ga0123356_10253906 Ga0123356_102539062 390
20 3300010049 Ga0123356_10074053 Ga0123356_100740531 394
21 3300042659 Ga0466733_013658 Ga0466733_013658_869_2080 394
22 3300042604 Ga0466717_186650 Ga0466717_186650_218_1429 397
23 3300002449 JGI24698J34947_10048882 JGI24698J34947_100488822 398
24 3300002504 JGI24705J35276_12171691 JGI24705J35276_121716911 398
25 3300042600 Ga0466700_327485 Ga0466700_327485_342_1541 399
26 3300042643 Ga0466704_080664 Ga0466704_080664_1458_2663 401
27 3300009784 Ga0123357_10255464 Ga0123357_102554642 403
28 3300024493 Ga0264413_102186 Ga0264413_1021861 403
29 3300042550 Ga0466656_098681 Ga0466656_098681_235_1446 403
30 3300042582 Ga0466657_281849 Ga0466657_281849_159_1370 403
31 3300042592 Ga0466693_018703 Ga0466693_018703_81_1292 403
32 3300042592 Ga0466693_230814 Ga0466693_230814_69_1280 403
33 3300042594 Ga0466694_253201 Ga0466694_253201_99_1310 403
34 3300042595 Ga0466695_052245 Ga0466695_052245_1473_2684 403
35 3300042595 Ga0466695_097484 Ga0466695_097484_408_1619 403
36 3300042595 Ga0466695_164252 Ga0466695_164252_133_1344 403
37 3300042595 Ga0466695_268924 Ga0466695_268924_113_1324 403
38 3300042595 Ga0466695_342048 Ga0466695_342048_184_1395 403
39 3300042597 Ga0466699_099710 Ga0466699_099710_52_1263 403
40 3300042597 Ga0466699_195560 Ga0466699_195560_46_1257 403
41 3300042597 Ga0466699_199978 Ga0466699_199978_268_1479 403
42 3300042597 Ga0466699_251267 Ga0466699_251267_67_1278 403
43 3300042597 Ga0466699_388375 Ga0466699_388375_11_1222 403
44 3300042598 Ga0466701_024538 Ga0466701_024538_222_1433 403
45 3300042598 Ga0466701_026195 Ga0466701_026195_346_1557 403
46 3300042598 Ga0466701_026201 Ga0466701_026201_134_1345 403
47 3300042598 Ga0466701_051058 Ga0466701_051058_286_1497 403
48 3300042598 Ga0466701_067920 Ga0466701_067920_917_2128 403
49 3300042598 Ga0466701_093023 Ga0466701_093023_1283_2494 403
50 3300042600 Ga0466700_160533 Ga0466700_160533_139_1350 403
51 3300042600 Ga0466700_413563 Ga0466700_413563_213_1424 403
52 3300042604 Ga0466717_004357 Ga0466717_004357_196_1407 403
53 3300042604 Ga0466717_052321 Ga0466717_052321_171_1382 403
54 3300042604 Ga0466717_106792 Ga0466717_106792_300_1511 403
55 3300042604 Ga0466717_132902 Ga0466717_132902_160_1371 403
56 3300042604 Ga0466717_289709 Ga0466717_289709_286_1497 403
57 3300042607 Ga0466720_005612 Ga0466720_005612_387_1598 403
58 3300042607 Ga0466720_012628 Ga0466720_012628_771_1982 403
59 3300042607 Ga0466720_020302 Ga0466720_020302_11512_12723 403
60 3300042607 Ga0466720_102242 Ga0466720_102242_1800_3011 403
61 3300042607 Ga0466720_131747 Ga0466720_131747_781_1992 403
62 3300042607 Ga0466720_137009 Ga0466720_137009_132_1343 403
63 3300042608 Ga0466721_060938 Ga0466721_060938_376_1587 403
64 3300042608 Ga0466721_249486 Ga0466721_249486_123_1334 403
65 3300042608 Ga0466721_294841 Ga0466721_294841_1104_2315 403
66 3300042610 Ga0466698_161378 Ga0466698_161378_346_1557 403
67 3300042610 Ga0466698_200947 Ga0466698_200947_415_1626 403
68 3300042613 Ga0466710_103338 Ga0466710_103338_145_1356 403
69 3300042613 Ga0466710_286114 Ga0466710_286114_126_1337 403
70 3300042613 Ga0466710_327534 Ga0466710_327534_167_1378 403
71 3300042614 Ga0466712_037176 Ga0466712_037176_4115_5326 403
72 3300042614 Ga0466712_067302 Ga0466712_067302_2162_3373 403
73 3300042614 Ga0466712_144890 Ga0466712_144890_280_1491 403
74 3300042614 Ga0466712_188083 Ga0466712_188083_50_1261 403
75 3300042617 Ga0466718_000599 Ga0466718_000599_77_1288 403
76 3300042617 Ga0466718_028803 Ga0466718_028803_130_1341 403
77 3300042617 Ga0466718_034012 Ga0466718_034012_152_1363 403
78 3300042617 Ga0466718_097294 Ga0466718_097294_340_1551 403
79 3300042622 Ga0466731_063476 Ga0466731_063476_296_1507 403
80 3300042622 Ga0466731_080436 Ga0466731_080436_566_1777 403
81 3300042622 Ga0466731_091526 Ga0466731_091526_117_1328 403
82 3300042622 Ga0466731_127324 Ga0466731_127324_34_1245 403
83 3300042622 Ga0466731_291010 Ga0466731_291010_232_1443 403
84 3300042623 Ga0466734_161905 Ga0466734_161905_100_1311 403
85 3300042625 Ga0466730_071113 Ga0466730_071113_706_1917 403
86 3300042635 Ga0466702_292566 Ga0466702_292566_572_1783 403
87 3300042635 Ga0466702_464579 Ga0466702_464579_321_1532 403
88 3300042649 Ga0466724_02892 Ga0466724_02892_142_1353 403
89 3300042655 Ga0466727_178245 Ga0466727_178245_205_1416 403
90 3300042655 Ga0466727_279836 Ga0466727_279836_130_1341 403
91 3300042655 Ga0466727_327802 Ga0466727_327802_115_1326 403
92 3300042656 Ga0466732_345396 Ga0466732_345396_169_1380 403
93 3300042659 Ga0466733_026948 Ga0466733_026948_486_1697 403
94 3300000089 AustNasuHG_c1004897 AustNasuHG_10048972 404
95 3300000089 AustNasuHG_c1031205 AustNasuHG_10312051 404
96 3300000089 AustNasuHG_c1034342 AustNasuHG_10343421 404
97 3300002449 JGI24698J34947_10048024 JGI24698J34947_100480242 404
98 3300002449 JGI24698J34947_10093542 JGI24698J34947_100935421 404
99 3300002450 JGI24695J34938_10070326 JGI24695J34938_100703261 404
100 3300002450 JGI24695J34938_10083216 JGI24695J34938_100832161 404
101 3300002462 JGI24702J35022_10124913 JGI24702J35022_101249132 404
102 3300002462 JGI24702J35022_10130966 JGI24702J35022_101309661 404
103 3300002509 JGI24699J35502_11003614 JGI24699J35502_110036141 404
104 3300005485 Ga0074263_110016 Ga0074263_1100162 404
105 3300009784 Ga0123357_10257477 Ga0123357_102574772 404
106 3300009826 Ga0123355_10437824 Ga0123355_104378241 404
107 3300010049 Ga0123356_10239984 Ga0123356_102399842 404
108 3300010049 Ga0123356_10373893 Ga0123356_103738931 404
109 3300010049 Ga0123356_10379238 Ga0123356_103792382 404
110 3300010167 Ga0123353_10141166 Ga0123353_101411662 404
111 3300010167 Ga0123353_10333468 Ga0123353_103334682 404
112 3300010167 Ga0123353_10580524 Ga0123353_105805241 404
113 3300010167 Ga0123353_10604981 Ga0123353_106049812 404
114 3300042612 Ga0466705_223408 Ga0466705_223408_203_1417 404
115 3300042617 Ga0466718_001140 Ga0466718_001140_477_1718 413

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00872 Transposase_mut Transposase, Mutator family 29 390 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.65 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.