Protein Family IF07810
Metagenome
Isolate
216
Members
63
Samples
201
Scaffolds
233.93
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_465262|Ga0466715_465262_615_1484
- Length
- 289 aa
- Sequence
- VKRQVNAGSGLNPNIRNGLNIGYFYSFNAGNEKIIKIHIKIKKNSYFCATKHCFKIQMHRNEDEFLDFSSSLTDVWRLLSVQERDSLRKTASVQHFKKNQKIYSAGDEPENLMCLLNGKVKIYKEGIGGRNQIIRIIKPIQYFAYRAYFAKEKYLTDAAAFEPSVVCMIPMTLLNNILKDNFSLCMFFIRQLSVDLGIAEERTVNLTQKHIRGRLAESLIFLIDSYGLEDDKTINIYLAREDLANLSNMTTANAIRTLSTFASEKVIALDGRKIKVLDEEKLRKISKLG
Sample Types
Isolate
6.9%
Metagenome
93.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.0%
Kalotermitidae
22.6%
Unclassified
12.9%
Blattidae
11.3%
Rhinotermitidae
6.5%
Termopsidae
6.5%
Passalidae
4.8%
Hydrophilidae
3.2%
Tenebrionidae
1.6%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
206
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 2 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 3 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 6 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 9 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 20 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 21 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 22 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 23 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 29 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 30 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 31 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 32 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 41 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 42 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 44 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 45 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 46 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 47 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 48 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 49 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 50 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 51 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 52 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 53 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 54 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 55 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 56 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 57 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 58 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 59 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 60 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 61 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 63 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | 2227072446 | 2225789003 | Bacteria | 12951 |
| 2 | JGI24702J35022_10022247 | 3300002462 | Bacteria | 3433 |
| 3 | Ga0466705_386420 | 3300042612 | Bacteria | 2088 |
| 4 | Ga0466713_102907 | 3300042602 | Bacteria | 38987 |
| 5 | Ga0466716_163238 | 3300042605 | Bacteria | 17359 |
| 6 | Ga0466735_127635 | 3300042624 | Bacteria | 5896 |
| 7 | Ga0466704_048466 | 3300042643 | Bacteria | 4649 |
| 8 | Ga0466704_432232 | 3300042643 | Unclassified | 4681 |
| 9 | Ga0466709_221215 | 3300042648 | Bacteria | 16956 |
| 10 | Ga0466727_024562 | 3300042655 | Bacteria | 14593 |
| 11 | Ga0123354_10131475 | 3300010882 | Bacteria | 3159 |
| 12 | Ga0466711_083663 | 3300042615 | Bacteria | 8945 |
| 13 | Ga0466711_157753 | 3300042615 | Bacteria | 10462 |
| 14 | Ga0466711_283500 | 3300042615 | Unclassified | 3437 |
| 15 | Ga0466728_026287 | 3300042620 | Bacteria | 61001 |
| 16 | Ga0466692_075152 | 3300042591 | Bacteria | 13452 |
| 17 | Ga0466696_017263 | 3300042596 | Bacteria | 7070 |
| 18 | 2227091915 | 2225789004 | Bacteria | 9847 |
| 19 | 2227281106 | 2225789004 | Bacteria | 1259 |
| 20 | 2227498242 | 2225789004 | Bacteria | 3874 |
| 21 | 2227509641 | 2225789004 | Bacteria | 3594 |
| 22 | IMNBL1DRAFT_c0003035 | 3300000062 | Bacteria | 11106 |
| 23 | IMNBL1DRAFT_c0004317 | 3300000062 | Bacteria | 8590 |
| 24 | JGI24702J35022_10003518 | 3300002462 | Bacteria | 9431 |
| 25 | JGI24705J35276_12233643 | 3300002504 | Bacteria | 4968 |
| 26 | Ga0068305_10022527 | 3300005083 | Unclassified | 3196 |
| 27 | Ga0068305_10043967 | 3300005083 | Bacteria | 8071 |
| 28 | Ga0466705_099969 | 3300042612 | Bacteria | 49190 |
| 29 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 30 | Ga0466707_130395 | 3300042601 | Bacteria | 8519 |
| 31 | Ga0466707_146418 | 3300042601 | Bacteria | 49406 |
| 32 | Ga0466707_345434 | 3300042601 | Bacteria | 28806 |
| 33 | Ga0466713_054810 | 3300042602 | Bacteria | 3609 |
| 34 | Ga0466713_059533 | 3300042602 | Bacteria | 12857 |
| 35 | Ga0466716_243820 | 3300042605 | Bacteria | 3017 |
| 36 | Ga0466716_312273 | 3300042605 | Bacteria | 24118 |
| 37 | Ga0466698_141822 | 3300042610 | Bacteria | 2294 |
| 38 | Ga0466698_378617 | 3300042610 | Bacteria | 2139 |
| 39 | Ga0466703_036019 | 3300042636 | Bacteria | 12615 |
| 40 | Ga0466703_342632 | 3300042636 | Bacteria | 3089 |
| 41 | Ga0466703_410999 | 3300042636 | Bacteria | 5482 |
| 42 | Ga0466708_363361 | 3300042652 | Bacteria | 12623 |
| 43 | Ga0123357_10016803 | 3300009784 | Bacteria | 9654 |
| 44 | Ga0123357_10050186 | 3300009784 | Unclassified | 5649 |
| 45 | Ga0123354_10037202 | 3300010882 | Bacteria | 7578 |
| 46 | Ga0466711_384875 | 3300042615 | Bacteria | 47167 |
| 47 | Ga0466715_151713 | 3300042616 | Bacteria | 9966 |
| 48 | Ga0466723_156953 | 3300042618 | Bacteria | 17921 |
| 49 | Ga0466723_340002 | 3300042618 | Bacteria | 6898 |
| 50 | Ga0466690_291609 | 3300042590 | Bacteria | 13482 |
| 51 | Ga0466692_094398 | 3300042591 | Bacteria | 10447 |
| 52 | Ga0466691_173246 | 3300042593 | Bacteria | 3566 |
| 53 | Ga0466694_383601 | 3300042594 | Bacteria | 4141 |
| 54 | Ga0466696_313638 | 3300042596 | Bacteria | 2932 |
| 55 | 2227488530 | 2225789004 | Bacteria | 20877 |
| 56 | JGI24696J40584_12781257 | 3300002834 | Bacteria | 837 |
| 57 | Ga0466701_041820 | 3300042598 | Bacteria | 1355 |
| 58 | Ga0466700_044713 | 3300042600 | Bacteria | 11766 |
| 59 | Ga0466700_222356 | 3300042600 | Bacteria | 20172 |
| 60 | Ga0466713_133464 | 3300042602 | Bacteria | 1343 |
| 61 | Ga0466714_041531 | 3300042603 | Bacteria | 1669 |
| 62 | Ga0466716_494654 | 3300042605 | Bacteria | 6477 |
| 63 | Ga0466719_061701 | 3300042606 | Bacteria | 8794 |
| 64 | Ga0466719_136023 | 3300042606 | Bacteria | 12051 |
| 65 | Ga0466722_245313 | 3300042609 | Bacteria | 2130 |
| 66 | Ga0466735_064123 | 3300042624 | Bacteria | 2582 |
| 67 | Ga0466704_082857 | 3300042643 | Bacteria | 4021 |
| 68 | Ga0123357_10008804 | 3300009784 | Bacteria | 12660 |
| 69 | Ga0123357_10010307 | 3300009784 | Bacteria | 11875 |
| 70 | Ga0123353_10124447 | 3300010167 | Bacteria | 4144 |
| 71 | Ga0123354_10311282 | 3300010882 | Bacteria | 1470 |
| 72 | Ga0466715_377469 | 3300042616 | Bacteria | 15072 |
| 73 | Ga0466723_239231 | 3300042618 | Bacteria | 2811 |
| 74 | Ga0466726_270156 | 3300042619 | Bacteria | 11623 |
| 75 | Ga0466728_030621 | 3300042620 | Bacteria | 20610 |
| 76 | Ga0466690_023424 | 3300042590 | Bacteria | 5456 |
| 77 | Ga0466695_343788 | 3300042595 | Bacteria | 1424 |
| 78 | 2227208575 | 2225789004 | Bacteria | 7661 |
| 79 | IMNBL1DRAFT_c0001301 | 3300000062 | Bacteria | 18778 |
| 80 | JGI24698J34947_10090869 | 3300002449 | Bacteria | 1402 |
| 81 | JGI24702J35022_10001619 | 3300002462 | Bacteria | 13929 |
| 82 | JGI24702J35022_10009367 | 3300002462 | Bacteria | 5500 |
| 83 | JGI24702J35022_10033627 | 3300002462 | Bacteria | 2743 |
| 84 | JGI24702J35022_10051982 | 3300002462 | Bacteria | 2183 |
| 85 | JGI24705J35276_12238403 | 3300002504 | Bacteria | 21135 |
| 86 | JGI24699J35502_11134206 | 3300002509 | Bacteria | 57169 |
| 87 | JGI24699J35502_11134227 | 3300002509 | Bacteria | 76542 |
| 88 | JGI24696J40584_12956005 | 3300002834 | Bacteria | 2987 |
| 89 | Ga0068305_10521110 | 3300005083 | Bacteria | 1757 |
| 90 | Ga0466733_125775 | 3300042659 | Bacteria | 1976 |
| 91 | Ga0466707_210070 | 3300042601 | Bacteria | 4144 |
| 92 | Ga0466713_012389 | 3300042602 | Bacteria | 9211 |
| 93 | Ga0466713_044806 | 3300042602 | Bacteria | 5986 |
| 94 | Ga0466713_095637 | 3300042602 | Bacteria | 1728 |
| 95 | Ga0466713_117800 | 3300042602 | Bacteria | 6200 |
| 96 | Ga0466716_018555 | 3300042605 | Bacteria | 33125 |
| 97 | Ga0466716_346281 | 3300042605 | Bacteria | 7412 |
| 98 | Ga0466722_085395 | 3300042609 | Bacteria | 6738 |
| 99 | Ga0466703_042063 | 3300042636 | Bacteria | 5497 |
| 100 | Ga0466703_181393 | 3300042636 | Bacteria | 10659 |
| 101 | Ga0466709_292580 | 3300042648 | Bacteria | 8167 |
| 102 | Ga0466709_382075 | 3300042648 | Bacteria | 15070 |
| 103 | Ga0466727_266424 | 3300042655 | Bacteria | 8793 |
| 104 | Ga0123354_10009475 | 3300010882 | Bacteria | 14914 |
| 105 | Ga0466711_006423 | 3300042615 | Bacteria | 3832 |
| 106 | Ga0466711_043535 | 3300042615 | Bacteria | 2813 |
| 107 | Ga0466711_244447 | 3300042615 | Bacteria | 2479 |
| 108 | Ga0466715_426635 | 3300042616 | Bacteria | 10987 |
| 109 | Ga0466728_252273 | 3300042620 | Bacteria | 1883 |
| 110 | Ga0466656_064855 | 3300042550 | Bacteria | 7925 |
| 111 | Ga0466690_352002 | 3300042590 | Bacteria | 11272 |
| 112 | Ga0466696_188727 | 3300042596 | Bacteria | 4320 |
| 113 | Ga0466696_427305 | 3300042596 | Bacteria | 1192 |
| 114 | IMNBL1DRAFT_c0001047 | 3300000062 | Bacteria | 21395 |
| 115 | JGI24702J35022_10023669 | 3300002462 | Bacteria | 3320 |
| 116 | JGI24699J35502_11133094 | 3300002509 | Bacteria | 8675 |
| 117 | Ga0072941_1203419 | 3300005201 | Bacteria | 2523 |
| 118 | Ga0123357_10000612 | 3300009784 | Bacteria | 35430 |
| 119 | Ga0466697_226398 | 3300042611 | Bacteria | 1804 |
| 120 | Ga0466705_031523 | 3300042612 | Unclassified | 7491 |
| 121 | Ga0466733_088649 | 3300042659 | Bacteria | 26069 |
| 122 | Ga0466713_045754 | 3300042602 | Bacteria | 8401 |
| 123 | Ga0466722_237730 | 3300042609 | Unclassified | 3999 |
| 124 | Ga0466704_060179 | 3300042643 | Bacteria | 10657 |
| 125 | Ga0466704_080317 | 3300042643 | Bacteria | 16199 |
| 126 | Ga0466704_304523 | 3300042643 | Bacteria | 6110 |
| 127 | Ga0466727_026605 | 3300042655 | Bacteria | 6488 |
| 128 | Ga0123357_10016864 | 3300009784 | Unclassified | 9637 |
| 129 | Ga0123357_10360290 | 3300009784 | Bacteria | 1378 |
| 130 | Ga0123354_10045962 | 3300010882 | Bacteria | 6676 |
| 131 | Ga0466711_041848 | 3300042615 | Bacteria | 64215 |
| 132 | Ga0466711_048662 | 3300042615 | Bacteria | 31707 |
| 133 | Ga0466715_119024 | 3300042616 | Bacteria | 12209 |
| 134 | Ga0466690_153982 | 3300042590 | Bacteria | 10875 |
| 135 | Ga0466691_001749 | 3300042593 | Unclassified | 13647 |
| 136 | Ga0466696_244227 | 3300042596 | Bacteria | 2212 |
| 137 | 2227582967 | 2225789004 | Bacteria | 2493 |
| 138 | JGI24702J35022_10000263 | 3300002462 | Bacteria | 30153 |
| 139 | JGI24699J35502_11124498 | 3300002509 | Bacteria | 3673 |
| 140 | Ga0068302_10055338 | 3300005071 | Bacteria | 4740 |
| 141 | Ga0068305_10087968 | 3300005083 | Bacteria | 23515 |
| 142 | Ga0068305_10088138 | 3300005083 | Bacteria | 6220 |
| 143 | Ga0123357_10001276 | 3300009784 | Bacteria | 26508 |
| 144 | Ga0466705_209839 | 3300042612 | Bacteria | 1642 |
| 145 | Ga0466733_035383 | 3300042659 | Bacteria | 60826 |
| 146 | Ga0466713_088791 | 3300042602 | Bacteria | 9773 |
| 147 | Ga0466713_113431 | 3300042602 | Bacteria | 4239 |
| 148 | Ga0466713_133473 | 3300042602 | Bacteria | 3770 |
| 149 | Ga0466698_305275 | 3300042610 | Bacteria | 3858 |
| 150 | Ga0123357_10006966 | 3300009784 | Bacteria | 13896 |
| 151 | Ga0123357_10036203 | 3300009784 | Bacteria | 6716 |
| 152 | Ga0466715_188075 | 3300042616 | Bacteria | 87062 |
| 153 | Ga0466715_397426 | 3300042616 | Bacteria | 7446 |
| 154 | Ga0466715_612586 | 3300042616 | Bacteria | 28878 |
| 155 | Ga0466726_066733 | 3300042619 | Bacteria | 1300 |
| 156 | Ga0466690_198924 | 3300042590 | Bacteria | 34985 |
| 157 | Ga0466690_212519 | 3300042590 | Unclassified | 7115 |
| 158 | Ga0466690_254172 | 3300042590 | Bacteria | 86143 |
| 159 | Ga0466696_131716 | 3300042596 | Bacteria | 2390 |
| 160 | Ga0466696_159608 | 3300042596 | Bacteria | 4706 |
| 161 | Ga0466696_188738 | 3300042596 | Bacteria | 16635 |
| 162 | 2227472436 | 2225789004 | Bacteria | 4804 |
| 163 | IMNBL1DRAFT_c0048159 | 3300000062 | Unclassified | 1369 |
| 164 | JGI24698J34947_10058060 | 3300002449 | Bacteria | 1917 |
| 165 | Ga0466706_163906 | 3300042599 | Bacteria | 105365 |
| 166 | Ga0466713_055966 | 3300042602 | Bacteria | 71857 |
| 167 | Ga0466716_105802 | 3300042605 | Bacteria | 11974 |
| 168 | Ga0466722_049476 | 3300042609 | Bacteria | 19365 |
| 169 | Ga0466735_062068 | 3300042624 | Bacteria | 3817 |
| 170 | Ga0466703_114630 | 3300042636 | Bacteria | 39473 |
| 171 | Ga0466704_077214 | 3300042643 | Bacteria | 23234 |
| 172 | Ga0466708_016107 | 3300042652 | Bacteria | 19240 |
| 173 | Ga0123357_10019688 | 3300009784 | Bacteria | 9002 |
| 174 | Ga0123354_10170660 | 3300010882 | Bacteria | 2533 |
| 175 | Ga0466705_519831 | 3300042612 | Bacteria | 4677 |
| 176 | Ga0466710_271525 | 3300042613 | Bacteria | 1300 |
| 177 | Ga0466715_212915 | 3300042616 | Bacteria | 24334 |
| 178 | Ga0466715_465262 | 3300042616 | Bacteria | 8035 |
| 179 | Ga0466723_016799 | 3300042618 | Bacteria | 10753 |
| 180 | Ga0466726_482034 | 3300042619 | Bacteria | 2051 |
| 181 | Ga0466728_018983 | 3300042620 | Bacteria | 6115 |
| 182 | Ga0466691_013448 | 3300042593 | Bacteria | 43223 |
| 183 | IMNBL1DRAFT_c0002623 | 3300000062 | Bacteria | 12337 |
| 184 | IMNBL1DRAFT_c0005196 | 3300000062 | Bacteria | 7533 |
| 185 | JGI24702J35022_10014879 | 3300002462 | Bacteria | 4285 |
| 186 | Ga0466707_147018 | 3300042601 | Bacteria | 6922 |
| 187 | Ga0466707_154337 | 3300042601 | Bacteria | 5566 |
| 188 | Ga0466713_018261 | 3300042602 | Bacteria | 10214 |
| 189 | Ga0466713_078721 | 3300042602 | Bacteria | 3468 |
| 190 | Ga0466719_148389 | 3300042606 | Bacteria | 25322 |
| 191 | Ga0466703_135494 | 3300042636 | Bacteria | 14367 |
| 192 | Ga0466704_041276 | 3300042643 | Bacteria | 1320 |
| 193 | Ga0466704_461175 | 3300042643 | Bacteria | 21896 |
| 194 | Ga0466727_310337 | 3300042655 | Bacteria | 2798 |
| 195 | Ga0466726_024398 | 3300042619 | Bacteria | 3241 |
| 196 | Ga0466729_091605 | 3300042621 | Bacteria | 3245 |
| 197 | Ga0466729_097238 | 3300042621 | Bacteria | 11917 |
| 198 | Ga0466656_312695 | 3300042550 | Bacteria | 1979 |
| 199 | Ga0466691_037723 | 3300042593 | Bacteria | 24924 |
| 200 | Ga0466694_309565 | 3300042594 | Bacteria | 1403 |
| 201 | Ga0466696_137422 | 3300042596 | Bacteria | 27896 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.