Protein Family IF07790
Metagenome
Isolate
207
Members
50
Samples
200
Scaffolds
368.27
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_414800|Ga0466715_414800_1408_2673
- Length
- 421 aa
- Sequence
- LPYLYRTITAWECQYENEYHFYFINEKTDTRSGLFNAVENGSIEKIRQIGKNKLMGSKVHFSLLLIFFLFPVIRSAAQEDPFSSFSDPSRIWGNGIEKVIEEAFRLCFKTRILGGKVMNLRMPFAQNNERDKLSDTGWVFLEGGKGSPETLWPAIETIIDSADFKTYIDTISDGKEKVLIFDIPTQTWTSSRELFELARMKAGAYRGLPHRPYVYVQGRGIEEADVYNYLYCVGLAGMDCSAFVWHTLSYIAKSGGLDLGRALRGTLGVRPGDNPARYAGTAFFDSRSREIITVKDEIRNLRPADIVLFRGPDGDAAHSAIIQSVDFKRGVLRYLQCTDEAPLAERGVHESFVYFDPASPGMSLGDPSLRWPQKRYPPFPGEKASPFSEDGERYRAFPEHGGGKVVRLRRLQSVIEKINRQ
Sample Types
Isolate
3.4%
Metagenome
96.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.6%
Kalotermitidae
29.2%
Unclassified
14.6%
Rhinotermitidae
8.3%
Termopsidae
4.2%
Hodotermitidae
2.1%
Blaberidae
2.1%
Taxonomy
Archaea
0
Bacteria
197
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 14 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 15 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 16 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 17 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 28 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 32 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 37 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 45 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 46 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 47 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 48 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_097753 | 3300042656 | Bacteria | 12353 |
| 2 | Ga0466712_008145 | 3300042614 | Bacteria | 5985 |
| 3 | Ga0466712_033547 | 3300042614 | Bacteria | 9388 |
| 4 | Ga0466718_147389 | 3300042617 | Bacteria | 2120 |
| 5 | Ga0466723_135084 | 3300042618 | Bacteria | 12031 |
| 6 | Ga0466728_095741 | 3300042620 | Bacteria | 4919 |
| 7 | Ga0466728_323963 | 3300042620 | Bacteria | 2919 |
| 8 | Ga0264413_104693 | 3300024493 | Bacteria | 10075 |
| 9 | Ga0466694_027819 | 3300042594 | Bacteria | 46301 |
| 10 | Ga0466699_061462 | 3300042597 | Bacteria | 3767 |
| 11 | Ga0466699_092865 | 3300042597 | Bacteria | 14102 |
| 12 | Ga0466699_438314 | 3300042597 | Bacteria | 23477 |
| 13 | Ga0466719_111676 | 3300042606 | Bacteria | 13944 |
| 14 | Ga0466719_271428 | 3300042606 | Bacteria | 1747 |
| 15 | Ga0466720_042792 | 3300042607 | Bacteria | 13446 |
| 16 | Ga0466722_077890 | 3300042609 | Bacteria | 10957 |
| 17 | AustNasuHG_c1001534 | 3300000089 | Bacteria | 8303 |
| 18 | JGI24698J34947_10004225 | 3300002449 | Bacteria | 7809 |
| 19 | JGI24698J34947_10006299 | 3300002449 | Unclassified | 6520 |
| 20 | JGI24695J34938_10015107 | 3300002450 | Bacteria | 3973 |
| 21 | Ga0466703_212383 | 3300042636 | Bacteria | 15812 |
| 22 | Ga0466703_430556 | 3300042636 | Bacteria | 37676 |
| 23 | Ga0466704_041021 | 3300042643 | Unclassified | 11309 |
| 24 | Ga0466709_102205 | 3300042648 | Bacteria | 2242 |
| 25 | Ga0466708_265538 | 3300042652 | Bacteria | 3241 |
| 26 | Ga0466705_213002 | 3300042612 | Bacteria | 2956 |
| 27 | Ga0466732_070823 | 3300042656 | Bacteria | 7740 |
| 28 | Ga0466712_011061 | 3300042614 | Bacteria | 35143 |
| 29 | Ga0466712_119671 | 3300042614 | Bacteria | 15965 |
| 30 | Ga0466712_150060 | 3300042614 | Bacteria | 1664 |
| 31 | Ga0466712_159658 | 3300042614 | Bacteria | 2974 |
| 32 | Ga0466715_009553 | 3300042616 | Bacteria | 13137 |
| 33 | Ga0466715_552313 | 3300042616 | Bacteria | 4020 |
| 34 | Ga0466723_186545 | 3300042618 | Bacteria | 7279 |
| 35 | Ga0466723_234697 | 3300042618 | Bacteria | 3156 |
| 36 | Ga0466723_357060 | 3300042618 | Bacteria | 15345 |
| 37 | Ga0466726_273218 | 3300042619 | Bacteria | 10389 |
| 38 | Ga0466728_023132 | 3300042620 | Bacteria | 6373 |
| 39 | Ga0123354_10012082 | 3300010882 | Bacteria | 13367 |
| 40 | Ga0466690_343326 | 3300042590 | Unclassified | 2471 |
| 41 | Ga0466691_216465 | 3300042593 | Bacteria | 9806 |
| 42 | Ga0466694_047190 | 3300042594 | Bacteria | 1155 |
| 43 | Ga0466696_213632 | 3300042596 | Bacteria | 2051 |
| 44 | Ga0466699_042104 | 3300042597 | Bacteria | 8688 |
| 45 | Ga0466699_356432 | 3300042597 | Bacteria | 5268 |
| 46 | JGI24698J34947_10027637 | 3300002449 | Bacteria | 3009 |
| 47 | JGI24698J34947_10027806 | 3300002449 | Bacteria | 3000 |
| 48 | Ga0072940_1000987 | 3300005200 | Bacteria | 12602 |
| 49 | Ga0072940_1003939 | 3300005200 | Unclassified | 9783 |
| 50 | Ga0466703_129287 | 3300042636 | Bacteria | 10162 |
| 51 | Ga0466703_372376 | 3300042636 | Bacteria | 3226 |
| 52 | Ga0466704_016320 | 3300042643 | Bacteria | 7761 |
| 53 | Ga0466704_074055 | 3300042643 | Bacteria | 16245 |
| 54 | Ga0466704_394912 | 3300042643 | Bacteria | 39080 |
| 55 | Ga0466704_529366 | 3300042643 | Bacteria | 8938 |
| 56 | Ga0466708_092126 | 3300042652 | Bacteria | 7003 |
| 57 | Ga0466708_347095 | 3300042652 | Bacteria | 14005 |
| 58 | Ga0466727_128654 | 3300042655 | Bacteria | 1880 |
| 59 | Ga0466705_208469 | 3300042612 | Bacteria | 7012 |
| 60 | Ga0466715_205671 | 3300042616 | Bacteria | 6319 |
| 61 | Ga0466718_084868 | 3300042617 | Bacteria | 2426 |
| 62 | Ga0466723_228009 | 3300042618 | Bacteria | 4540 |
| 63 | Ga0466723_259018 | 3300042618 | Bacteria | 7782 |
| 64 | Ga0466723_372532 | 3300042618 | Bacteria | 4311 |
| 65 | Ga0123353_10017168 | 3300010167 | Bacteria | 10620 |
| 66 | Ga0264413_106500 | 3300024493 | Unclassified | 6587 |
| 67 | Ga0466690_251085 | 3300042590 | Bacteria | 1522 |
| 68 | Ga0466699_261321 | 3300042597 | Bacteria | 20382 |
| 69 | Ga0466699_387255 | 3300042597 | Bacteria | 13675 |
| 70 | Ga0466720_083311 | 3300042607 | Bacteria | 2331 |
| 71 | Ga0466722_058967 | 3300042609 | Bacteria | 3725 |
| 72 | Ga0072940_1045070 | 3300005200 | Bacteria | 2904 |
| 73 | Ga0072941_1230103 | 3300005201 | Bacteria | 5324 |
| 74 | Ga0466703_139939 | 3300042636 | Bacteria | 21327 |
| 75 | Ga0466703_176234 | 3300042636 | Bacteria | 12049 |
| 76 | Ga0466704_045119 | 3300042643 | Bacteria | 10252 |
| 77 | Ga0466704_430812 | 3300042643 | Bacteria | 9278 |
| 78 | Ga0466709_263381 | 3300042648 | Bacteria | 12295 |
| 79 | Ga0466708_281186 | 3300042652 | Bacteria | 8570 |
| 80 | Ga0466727_167319 | 3300042655 | Bacteria | 8607 |
| 81 | Ga0466733_026089 | 3300042659 | Bacteria | 24560 |
| 82 | Ga0466733_034932 | 3300042659 | Bacteria | 17092 |
| 83 | Ga0466711_318451 | 3300042615 | Bacteria | 15242 |
| 84 | Ga0123356_10199670 | 3300010049 | Unclassified | 2038 |
| 85 | Ga0456237_0002238 | 3300041968 | Bacteria | 3129 |
| 86 | Ga0466692_079215 | 3300042591 | Bacteria | 2319 |
| 87 | Ga0466692_171821 | 3300042591 | Bacteria | 1702 |
| 88 | Ga0466691_058776 | 3300042593 | Bacteria | 6011 |
| 89 | Ga0466691_070762 | 3300042593 | Bacteria | 4269 |
| 90 | Ga0466694_277150 | 3300042594 | Bacteria | 1263 |
| 91 | Ga0466694_291072 | 3300042594 | Bacteria | 5697 |
| 92 | Ga0466694_307043 | 3300042594 | Bacteria | 1509 |
| 93 | Ga0466699_068265 | 3300042597 | Bacteria | 8433 |
| 94 | Ga0466699_219472 | 3300042597 | Bacteria | 1724 |
| 95 | Ga0466720_016569 | 3300042607 | Bacteria | 16233 |
| 96 | Ga0466720_040108 | 3300042607 | Bacteria | 48358 |
| 97 | Ga0072940_1016342 | 3300005200 | Bacteria | 3193 |
| 98 | Ga0072940_1025199 | 3300005200 | Bacteria | 5042 |
| 99 | Ga0074263_115272 | 3300005485 | Bacteria | 8090 |
| 100 | Ga0466703_023863 | 3300042636 | Bacteria | 11125 |
| 101 | Ga0466708_168255 | 3300042652 | Bacteria | 12219 |
| 102 | Ga0466708_267580 | 3300042652 | Bacteria | 5187 |
| 103 | Ga0466733_006289 | 3300042659 | Bacteria | 6559 |
| 104 | Ga0466712_045290 | 3300042614 | Unclassified | 2560 |
| 105 | Ga0466715_524769 | 3300042616 | Bacteria | 17670 |
| 106 | Ga0466723_294313 | 3300042618 | Bacteria | 2014 |
| 107 | Ga0123353_10735076 | 3300010167 | Bacteria | 1377 |
| 108 | Ga0466691_095675 | 3300042593 | Bacteria | 20573 |
| 109 | Ga0466699_102604 | 3300042597 | Bacteria | 2948 |
| 110 | Ga0466699_133070 | 3300042597 | Bacteria | 3736 |
| 111 | Ga0466700_303426 | 3300042600 | Bacteria | 1212 |
| 112 | Ga0466716_374186 | 3300042605 | Bacteria | 4237 |
| 113 | Ga0466716_415570 | 3300042605 | Bacteria | 1777 |
| 114 | Ga0466720_032370 | 3300042607 | Bacteria | 3574 |
| 115 | JGI24698J34947_10008689 | 3300002449 | Bacteria | 5572 |
| 116 | Ga0072941_1008242 | 3300005201 | Bacteria | 4218 |
| 117 | Ga0072941_1032229 | 3300005201 | Bacteria | 5581 |
| 118 | Ga0466704_141431 | 3300042643 | Bacteria | 9733 |
| 119 | Ga0466704_221312 | 3300042643 | Bacteria | 13647 |
| 120 | Ga0466704_293419 | 3300042643 | Bacteria | 12582 |
| 121 | Ga0466727_044046 | 3300042655 | Bacteria | 3272 |
| 122 | Ga0466727_095635 | 3300042655 | Bacteria | 9723 |
| 123 | Ga0466727_095687 | 3300042655 | Bacteria | 8107 |
| 124 | Ga0466705_001162 | 3300042612 | Bacteria | 5992 |
| 125 | Ga0466705_010044 | 3300042612 | Bacteria | 20765 |
| 126 | Ga0466705_133616 | 3300042612 | Bacteria | 12320 |
| 127 | Ga0466732_028317 | 3300042656 | Bacteria | 7961 |
| 128 | Ga0466711_127918 | 3300042615 | Bacteria | 5173 |
| 129 | Ga0466715_306652 | 3300042616 | Bacteria | 11984 |
| 130 | Ga0466718_135816 | 3300042617 | Bacteria | 20786 |
| 131 | Ga0466718_164930 | 3300042617 | Bacteria | 9550 |
| 132 | Ga0466723_092466 | 3300042618 | Bacteria | 14168 |
| 133 | Ga0466726_488583 | 3300042619 | Bacteria | 1582 |
| 134 | Ga0264413_103730 | 3300024493 | Bacteria | 3894 |
| 135 | Ga0466694_038164 | 3300042594 | Bacteria | 6629 |
| 136 | Ga0466696_081282 | 3300042596 | Bacteria | 17133 |
| 137 | Ga0466707_167682 | 3300042601 | Bacteria | 13743 |
| 138 | Ga0466720_074905 | 3300042607 | Bacteria | 2627 |
| 139 | Ga0466722_073484 | 3300042609 | Bacteria | 4678 |
| 140 | Ga0466722_224601 | 3300042609 | Bacteria | 12261 |
| 141 | AustNasuHG_c1000338 | 3300000089 | Bacteria | 16273 |
| 142 | AustNasuHG_c1028598 | 3300000089 | Bacteria | 1659 |
| 143 | JGI24698J34947_10011601 | 3300002449 | Bacteria | 4839 |
| 144 | JGI24698J34947_10055267 | 3300002449 | Bacteria | 1979 |
| 145 | JGI24695J34938_10000008 | 3300002450 | Bacteria | 136681 |
| 146 | JGI24695J34938_10000053 | 3300002450 | Bacteria | 90544 |
| 147 | JGI24699J35502_11123437 | 3300002509 | Bacteria | 3548 |
| 148 | Ga0466702_344385 | 3300042635 | Bacteria | 3711 |
| 149 | Ga0466702_460894 | 3300042635 | Bacteria | 11946 |
| 150 | Ga0466704_142711 | 3300042643 | Bacteria | 9980 |
| 151 | Ga0466712_045472 | 3300042614 | Unclassified | 12817 |
| 152 | Ga0466715_325677 | 3300042616 | Bacteria | 1883 |
| 153 | Ga0466718_046207 | 3300042617 | Bacteria | 64941 |
| 154 | Ga0466728_037216 | 3300042620 | Bacteria | 9530 |
| 155 | Ga0466729_030368 | 3300042621 | Bacteria | 1264 |
| 156 | Ga0466690_110652 | 3300042590 | Bacteria | 14756 |
| 157 | Ga0466690_160007 | 3300042590 | Bacteria | 4117 |
| 158 | Ga0466692_074870 | 3300042591 | Bacteria | 20518 |
| 159 | Ga0466692_106084 | 3300042591 | Bacteria | 14312 |
| 160 | Ga0466696_173665 | 3300042596 | Bacteria | 1369 |
| 161 | Ga0466699_014071 | 3300042597 | Bacteria | 4084 |
| 162 | Ga0466699_128203 | 3300042597 | Bacteria | 5747 |
| 163 | Ga0466699_181233 | 3300042597 | Bacteria | 3516 |
| 164 | Ga0466699_196062 | 3300042597 | Bacteria | 6789 |
| 165 | Ga0466699_443634 | 3300042597 | Bacteria | 28955 |
| 166 | Ga0466716_107674 | 3300042605 | Bacteria | 4133 |
| 167 | Ga0466719_135385 | 3300042606 | Bacteria | 2272 |
| 168 | Ga0466719_141879 | 3300042606 | Bacteria | 2471 |
| 169 | Ga0466720_005189 | 3300042607 | Bacteria | 17082 |
| 170 | Ga0466722_107732 | 3300042609 | Bacteria | 6599 |
| 171 | JGI24698J34947_10000352 | 3300002449 | Bacteria | 20514 |
| 172 | JGI24698J34947_10017306 | 3300002449 | Bacteria | 3907 |
| 173 | JGI24695J34938_10000406 | 3300002450 | Bacteria | 41980 |
| 174 | Ga0466703_257579 | 3300042636 | Bacteria | 7551 |
| 175 | Ga0466704_168446 | 3300042643 | Bacteria | 2887 |
| 176 | Ga0466705_155528 | 3300042612 | Bacteria | 8988 |
| 177 | Ga0466733_110324 | 3300042659 | Bacteria | 12359 |
| 178 | Ga0466711_024828 | 3300042615 | Bacteria | 7735 |
| 179 | Ga0466715_414800 | 3300042616 | Bacteria | 3152 |
| 180 | Ga0466728_106358 | 3300042620 | Bacteria | 6193 |
| 181 | Ga0466728_282640 | 3300042620 | Bacteria | 7664 |
| 182 | Ga0123356_10449671 | 3300010049 | Bacteria | 1436 |
| 183 | Ga0123354_10023461 | 3300010882 | Bacteria | 9731 |
| 184 | Ga0466692_070177 | 3300042591 | Bacteria | 1922 |
| 185 | Ga0466691_015154 | 3300042593 | Bacteria | 5988 |
| 186 | Ga0466691_135864 | 3300042593 | Bacteria | 28869 |
| 187 | Ga0466696_315057 | 3300042596 | Bacteria | 7754 |
| 188 | Ga0466696_377210 | 3300042596 | Bacteria | 10041 |
| 189 | Ga0466706_023418 | 3300042599 | Bacteria | 2034 |
| 190 | Ga0466707_025208 | 3300042601 | Bacteria | 1282 |
| 191 | Ga0466720_018934 | 3300042607 | Bacteria | 104216 |
| 192 | Ga0466722_133590 | 3300042609 | Bacteria | 5045 |
| 193 | AustNasuHG_c1001374 | 3300000089 | Bacteria | 8711 |
| 194 | JGI24698J34947_10012973 | 3300002449 | Bacteria | 4552 |
| 195 | JGI24698J34947_10018597 | 3300002449 | Bacteria | 3752 |
| 196 | JGI24698J34947_10027944 | 3300002449 | Bacteria | 2991 |
| 197 | JGI24698J34947_10082704 | 3300002449 | Unclassified | 1500 |
| 198 | JGI24702J35022_10039606 | 3300002462 | Bacteria | 2514 |
| 199 | Ga0466704_162219 | 3300042643 | Unclassified | 1632 |
| 200 | Ga0466708_033205 | 3300042652 | Bacteria | 1909 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.