Protein Family IF07775

Metagenome Isolate
138 Members
52 Samples
118 Scaffolds
142.81 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_375768|Ga0466715_375768_761_1189
Length
142 aa
Sequence
MLNKEEIQSLIPHRDPMLLIDEVIACVPGVSATAVKYLTGGESFLKGHFPEFPIMPGALTLEALAQTAAVAMALLPENKGRIGFFAGADGVRFKRKILPGDKIVLNVTIKNPRDAIVFADAQASVNGKIAAVAVISFGYGGK

📊 Sample Types

Isolate 14.5%
Metagenome 85.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 41.2%
Termitidae 41.2%
Kalotermitidae 9.8%
Passalidae 3.9%
Termopsidae 2.0%
Hodotermitidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
3 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
4 2820373881 Unclassified Firmicutes Nt197P3bin10 Isolate Unclassified
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
8 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
9 2820551407 Unclassified Firmicutes Emb289P4bin38 Isolate Unclassified
10 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
15 2820336130 Unclassified Firmicutes Nt197P3bin70 Isolate Unclassified
16 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
17 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
18 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
19 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
20 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
21 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
22 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
23 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
24 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
25 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
26 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
27 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
28 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
31 2820296961 Unclassified Firmicutes Th196P3bin102 Isolate Unclassified
32 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
33 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
34 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
35 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
36 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
37 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
38 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
39 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
43 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
44 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
45 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
46 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
47 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
48 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
49 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
50 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
52 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466706_059224 3300042599 Unclassified 12798
2 Ga0466706_089033 3300042599 Unclassified 1447
3 Ga0466706_110055 3300042599 Bacteria 2264
4 Ga0466706_136927 3300042599 Bacteria 6754
5 Ga0466706_189916 3300042599 Bacteria 94081
6 Ga0466706_261426 3300042599 Bacteria 28079
7 Ga0466716_241003 3300042605 Bacteria 1823
8 Ga0123355_10124448 3300009826 Bacteria 3989
9 Ga0123356_13328998 3300010049 Bacteria 558
10 Ga0123353_10190079 3300010167 Bacteria 3242
11 Ga0123353_13120556 3300010167 Bacteria 533
12 Ga0072941_1539583 3300005201 Bacteria 1044
13 Ga0466731_171327 3300042622 Bacteria 1590
14 Ga0415639_013066 3300038395 Bacteria 3818
15 Ga0415639_050443 3300038395 Bacteria 19223
16 Ga0415639_080784 3300038395 Bacteria 5509
17 Ga0466706_030763 3300042599 Bacteria 7119
18 Ga0466706_224602 3300042599 Bacteria 45610
19 Ga0466706_289207 3300042599 Bacteria 12318
20 Ga0466714_049014 3300042603 Bacteria 50282
21 Ga0466714_110126 3300042603 Bacteria 1105
22 Ga0466719_092328 3300042606 Bacteria 1231
23 Ga0123356_10664404 3300010049 Bacteria 1210
24 Ga0123356_12044575 3300010049 Bacteria 715
25 Ga0123353_10678766 3300010167 Bacteria 1451
26 Ga0123353_10826200 3300010167 Bacteria 1275
27 Ga0466710_377555 3300042613 Bacteria 1711
28 Ga0072940_1022884 3300005200 Bacteria 10281
29 Ga0123357_10000154 3300009784 Bacteria 61166
30 Ga0466706_168978 3300042599 Bacteria 3853
31 Ga0466706_221699 3300042599 Bacteria 6070
32 Ga0123356_10132094 3300010049 Bacteria 2448
33 Ga0123356_10855085 3300010049 Bacteria 1081
34 Ga0123353_10203790 3300010167 Bacteria 3109
35 Ga0123353_10237453 3300010167 Bacteria 2836
36 Ga0123353_12153715 3300010167 Bacteria 676
37 Ga0123354_10141507 3300010882 Bacteria 2972
38 Ga0466715_315153 3300042616 Bacteria 1900
39 Ga0466715_375768 3300042616 Bacteria 2002
40 Ga0072940_1076804 3300005200 Bacteria 11239
41 Ga0466701_070267 3300042598 Bacteria 1296
42 Ga0466706_245932 3300042599 Bacteria 5085
43 Ga0466717_095179 3300042604 Bacteria 1517
44 Ga0466717_242198 3300042604 Bacteria 1736
45 Ga0466719_165174 3300042606 Bacteria 5230
46 Ga0466698_273042 3300042610 Bacteria 1449
47 Ga0123356_10451776 3300010049 Bacteria 1433
48 Ga0123356_10724912 3300010049 Unclassified 1164
49 Ga0123353_10000031 3300010167 Bacteria 160211
50 Ga0123353_10729297 3300010167 Bacteria 1384
51 Ga0466705_434339 3300042612 Bacteria 1711
52 IMNBL1DRAFT_c0088510 3300000062 Bacteria 853
53 JGI24702J35022_10041107 3300002462 Bacteria 2465
54 Ga0415639_028806 3300038395 Bacteria 21603
55 Ga0466694_228035 3300042594 Bacteria 1001
56 Ga0466696_502532 3300042596 Bacteria 4908
57 Ga0466706_000520 3300042599 Bacteria 19181
58 Ga0466706_070458 3300042599 Bacteria 2547
59 Ga0466706_278542 3300042599 Unclassified 4016
60 Ga0466707_293849 3300042601 Bacteria 6525
61 Ga0466721_343588 3300042608 Unclassified 26917
62 Ga0466705_178276 3300042612 Bacteria 6243
63 Ga0123356_10061972 3300010049 Bacteria 3493
64 Ga0123356_10420270 3300010049 Bacteria 1479
65 Ga0123356_10545644 3300010049 Bacteria 1320
66 Ga0123353_10023656 3300010167 Bacteria 9308
67 2227633538 2225789004 Bacteria 2104
68 Ga0466702_448627 3300042635 Bacteria 11495
69 Ga0415639_007698 3300038395 Unclassified 5414
70 Ga0415639_016954 3300038395 Bacteria 7863
71 Ga0415639_161281 3300038395 Bacteria 3239
72 Ga0466706_012094 3300042599 Bacteria 88462
73 Ga0466706_104549 3300042599 Bacteria 39465
74 Ga0466706_151190 3300042599 Bacteria 1225
75 Ga0466706_171853 3300042599 Bacteria 18483
76 Ga0123356_10000494 3300010049 Bacteria 43925
77 Ga0123356_10008978 3300010049 Bacteria 9893
78 Ga0123356_10095900 3300010049 Bacteria 2836
79 JGI24696J40584_12930278 3300002834 Bacteria 1467
80 Ga0415639_001664 3300038395 Bacteria 18498
81 Ga0415639_001865 3300038395 Unclassified 4811
82 Ga0415639_067803 3300038395 Bacteria 3908
83 Ga0466706_004468 3300042599 Bacteria 2101
84 Ga0466706_193777 3300042599 Bacteria 1356
85 Ga0466706_221850 3300042599 Bacteria 18362
86 Ga0466717_313386 3300042604 Bacteria 1514
87 Ga0466721_348786 3300042608 Bacteria 1211
88 Ga0466698_498298 3300042610 Bacteria 1121
89 Ga0123356_10027531 3300010049 Bacteria 5325
90 Ga0123356_10110524 3300010049 Bacteria 2654
91 Ga0123356_10198714 3300010049 Bacteria 2043
92 Ga0123356_10649338 3300010049 Bacteria 1222
93 Ga0123353_10102674 3300010167 Unclassified 4609
94 Ga0123353_10703505 3300010167 Bacteria 1417
95 Ga0123353_11811707 3300010167 Bacteria 758
96 Ga0123353_11902353 3300010167 Bacteria 734
97 AustNasuHG_c1000104 3300000089 Bacteria 25311
98 JGI24702J35022_10022953 3300002462 Bacteria 3374
99 JGI24705J35276_12214158 3300002504 Bacteria 1950
100 Ga0068302_10743912 3300005071 Bacteria 838
101 Ga0415639_000039 3300038395 Bacteria 51214
102 Ga0415639_000274 3300038395 Bacteria 16988
103 Ga0415639_000888 3300038395 Bacteria 139331
104 Ga0415639_001192 3300038395 Bacteria 44530
105 Ga0415639_028841 3300038395 Unclassified 4504
106 Ga0415639_107503 3300038395 Bacteria 1094
107 Ga0466693_099306 3300042592 Bacteria 1078
108 Ga0466701_065899 3300042598 Bacteria 6883
109 Ga0466706_088417 3300042599 Unclassified 2816
110 Ga0466706_125246 3300042599 Bacteria 1574
111 Ga0466706_132280 3300042599 Bacteria 4375
112 Ga0466706_187318 3300042599 Bacteria 19293
113 Ga0466707_229516 3300042601 Bacteria 3031
114 Ga0466721_381796 3300042608 Bacteria 115209
115 Ga0123356_10000006 3300010049 Bacteria 247371
116 Ga0123353_10405386 3300010167 Bacteria 2027
117 Ga0415639_013719 3300038395 Bacteria 50988
118 Ga0415639_028805 3300038395 Bacteria 4122

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820294436 2820296583 139
2 iso_pr_bacteria 2820373881 2820374094 139
3 3300010049 Ga0123356_10027531 Ga0123356_100275316 140
4 3300005071 Ga0068302_10743912 Ga0068302_107439121 141
5 3300010167 Ga0123353_13120556 Ga0123353_131205561 141
6 3300038395 Ga0415639_000039 Ga0415639_000039_4999_5424 141
7 3300038395 Ga0415639_000274 Ga0415639_000274_15247_15672 141
8 3300038395 Ga0415639_000888 Ga0415639_000888_49715_50140 141
9 3300038395 Ga0415639_001192 Ga0415639_001192_25164_25589 141
10 3300038395 Ga0415639_001664 Ga0415639_001664_91_516 141
11 3300038395 Ga0415639_001865 Ga0415639_001865_3930_4355 141
12 3300038395 Ga0415639_007698 Ga0415639_007698_178_603 141
13 3300038395 Ga0415639_013066 Ga0415639_013066_2245_2670 141
14 3300038395 Ga0415639_013719 Ga0415639_013719_16475_16900 141
15 3300038395 Ga0415639_016954 Ga0415639_016954_525_950 141
16 3300038395 Ga0415639_028841 Ga0415639_028841_3931_4356 141
17 3300038395 Ga0415639_080784 Ga0415639_080784_4816_5241 141
18 3300038395 Ga0415639_107503 Ga0415639_107503_90_515 141
19 3300042596 Ga0466696_502532 Ga0466696_502532_2201_2626 141
20 3300042599 Ga0466706_059224 Ga0466706_059224_9849_10274 141
21 3300042599 Ga0466706_088417 Ga0466706_088417_1359_1784 141
22 3300042599 Ga0466706_104549 Ga0466706_104549_20992_21417 141
23 3300042599 Ga0466706_136927 Ga0466706_136927_1071_1496 141
24 3300042599 Ga0466706_151190 Ga0466706_151190_161_586 141
25 3300042599 Ga0466706_168978 Ga0466706_168978_2308_2733 141
26 3300042599 Ga0466706_171853 Ga0466706_171853_16601_17026 141
27 3300042599 Ga0466706_187318 Ga0466706_187318_17010_17435 141
28 3300042599 Ga0466706_189916 Ga0466706_189916_57241_57666 141
29 3300042599 Ga0466706_193777 Ga0466706_193777_455_880 141
30 3300042599 Ga0466706_278542 Ga0466706_278542_511_936 141
31 3300042599 Ga0466706_289207 Ga0466706_289207_8985_9410 141
32 3300042601 Ga0466707_229516 Ga0466707_229516_149_574 141
33 3300042601 Ga0466707_293849 Ga0466707_293849_3311_3736 141
34 3300042604 Ga0466717_095179 Ga0466717_095179_430_855 141
35 3300042606 Ga0466719_092328 Ga0466719_092328_768_1193 141
36 3300042606 Ga0466719_165174 Ga0466719_165174_2820_3245 141
37 3300042608 Ga0466721_343588 Ga0466721_343588_4069_4494 141
38 3300042608 Ga0466721_381796 Ga0466721_381796_86043_86468 141
39 3300042612 Ga0466705_434339 Ga0466705_434339_1093_1518 141
40 3300042635 Ga0466702_448627 Ga0466702_448627_2353_2778 141
41 iso_pr_bacteria 2820244222 2820246102 141
42 iso_pr_bacteria 2820254385 2820255397 141
43 iso_pr_bacteria 2820259584 2820261021 141
44 iso_pr_bacteria 2820288918 2820290426 141
45 iso_pr_bacteria 2820296961 2820297400 141
46 iso_pr_bacteria 2820319488 2820320463 141
47 iso_pr_bacteria 2820321184 2820322310 141
48 iso_pr_bacteria 2820560510 2820562104 141
49 iso_pr_bacteria 2820570671 2820571093 141
50 3300000089 AustNasuHG_c1000104 AustNasuHG_10001047 142
51 3300002462 JGI24702J35022_10041107 JGI24702J35022_100411073 142
52 3300005200 Ga0072940_1022884 Ga0072940_10228846 142
53 3300005200 Ga0072940_1076804 Ga0072940_10768047 142
54 3300009826 Ga0123355_10124448 Ga0123355_101244485 142
55 3300010049 Ga0123356_10000006 Ga0123356_10000006177 142
56 3300010049 Ga0123356_10000494 Ga0123356_1000049436 142
57 3300010049 Ga0123356_10061972 Ga0123356_100619723 142
58 3300010049 Ga0123356_10420270 Ga0123356_104202703 142
59 3300010049 Ga0123356_10545644 Ga0123356_105456442 142
60 3300010049 Ga0123356_10649338 Ga0123356_106493384 142
61 3300010049 Ga0123356_10724912 Ga0123356_107249122 142
62 3300010049 Ga0123356_13328998 Ga0123356_133289981 142
63 3300010167 Ga0123353_10000031 Ga0123353_10000031135 142
64 3300010167 Ga0123353_10102674 Ga0123353_101026742 142
65 3300010167 Ga0123353_10203790 Ga0123353_102037902 142
66 3300010167 Ga0123353_10678766 Ga0123353_106787662 142
67 3300010167 Ga0123353_10703505 Ga0123353_107035052 142
68 3300038395 Ga0415639_067803 Ga0415639_067803_2986_3414 142
69 3300042594 Ga0466694_228035 Ga0466694_228035_333_761 142
70 3300042603 Ga0466714_049014 Ga0466714_049014_39619_40047 142
71 3300042603 Ga0466714_110126 Ga0466714_110126_174_602 142
72 3300042604 Ga0466717_242198 Ga0466717_242198_586_1014 142
73 3300042604 Ga0466717_313386 Ga0466717_313386_320_748 142
74 3300042608 Ga0466721_348786 Ga0466721_348786_346_774 142
75 3300042612 Ga0466705_178276 Ga0466705_178276_4050_4478 142
76 3300042616 Ga0466715_375768 Ga0466715_375768_761_1189 142
77 iso_pr_bacteria 2820229114 2820231193 142
78 iso_pr_bacteria 2820250282 2820251759 142
79 iso_pr_bacteria 2820252425 2820253231 142
80 iso_pr_bacteria 2820280018 2820282053 142
81 iso_pr_bacteria 2820362221 2820362770 142
82 iso_pr_bacteria 2820551407 2820551574 142
83 3300000062 IMNBL1DRAFT_c0088510 IMNBL1DRAFT_00885102 143
84 3300002462 JGI24702J35022_10022953 JGI24702J35022_100229533 143
85 3300002504 JGI24705J35276_12214158 JGI24705J35276_122141582 143
86 3300009784 Ga0123357_10000154 Ga0123357_1000015430 143
87 3300010049 Ga0123356_10132094 Ga0123356_101320943 143
88 3300010049 Ga0123356_10198714 Ga0123356_101987144 143
89 3300010049 Ga0123356_10664404 Ga0123356_106644042 143
90 3300010049 Ga0123356_10855085 Ga0123356_108550851 143
91 3300010049 Ga0123356_12044575 Ga0123356_120445752 143
92 3300010167 Ga0123353_10405386 Ga0123353_104053862 143
93 3300010167 Ga0123353_10729297 Ga0123353_107292972 143
94 3300010167 Ga0123353_10826200 Ga0123353_108262002 143
95 3300010167 Ga0123353_11811707 Ga0123353_118117072 143
96 3300010167 Ga0123353_11902353 Ga0123353_119023531 143
97 3300010167 Ga0123353_12153715 Ga0123353_121537152 143
98 3300038395 Ga0415639_161281 Ga0415639_161281_461_892 143
99 3300042592 Ga0466693_099306 Ga0466693_099306_202_633 143
100 3300042599 Ga0466706_224602 Ga0466706_224602_33992_34423 143
101 3300042605 Ga0466716_241003 Ga0466716_241003_369_800 143
102 3300042610 Ga0466698_498298 Ga0466698_498298_94_525 143
103 3300042616 Ga0466715_315153 Ga0466715_315153_273_704 143
104 2225789004 2227633538 2228219152 144
105 3300010167 Ga0123353_10190079 Ga0123353_101900794 144
106 3300010167 Ga0123353_10237453 Ga0123353_102374533 144
107 3300010882 Ga0123354_10141507 Ga0123354_101415074 144
108 3300038395 Ga0415639_028806 Ga0415639_028806_17923_18357 144
109 3300042599 Ga0466706_004468 Ga0466706_004468_1492_1926 144
110 3300042598 Ga0466701_070267 Ga0466701_070267_775_1212 145
111 3300042599 Ga0466706_030763 Ga0466706_030763_4647_5084 145
112 3300042599 Ga0466706_070458 Ga0466706_070458_1039_1476 145
113 3300042599 Ga0466706_089033 Ga0466706_089033_43_480 145
114 3300042599 Ga0466706_110055 Ga0466706_110055_529_966 145
115 3300042599 Ga0466706_221699 Ga0466706_221699_2861_3298 145
116 3300042599 Ga0466706_221850 Ga0466706_221850_4981_5418 145
117 3300042599 Ga0466706_245932 Ga0466706_245932_613_1050 145
118 3300042599 Ga0466706_261426 Ga0466706_261426_12856_13293 145
119 3300042622 Ga0466731_171327 Ga0466731_171327_51_488 145
120 iso_pr_bacteria 2820336130 2820336957 145
121 iso_pr_bacteria 2820453354 2820453492 145
122 iso_pr_bacteria 2820576413 2820578301 145
123 3300002834 JGI24696J40584_12930278 JGI24696J40584_129302782 146
124 3300010049 Ga0123356_10008978 Ga0123356_100089789 146
125 3300010049 Ga0123356_10110524 Ga0123356_101105242 146
126 3300010167 Ga0123353_10023656 Ga0123353_1002365611 146
127 3300042598 Ga0466701_065899 Ga0466701_065899_3171_3611 146
128 3300042599 Ga0466706_000520 Ga0466706_000520_12179_12619 146
129 3300042599 Ga0466706_012094 Ga0466706_012094_84027_84467 146
130 3300042599 Ga0466706_132280 Ga0466706_132280_348_788 146
131 3300042610 Ga0466698_273042 Ga0466698_273042_587_1027 146
132 3300010049 Ga0123356_10451776 Ga0123356_104517764 147
133 3300038395 Ga0415639_050443 Ga0415639_050443_3604_4047 147
134 3300042599 Ga0466706_125246 Ga0466706_125246_157_600 147
135 3300042613 Ga0466710_377555 Ga0466710_377555_647_1093 148
136 3300010049 Ga0123356_10095900 Ga0123356_100959002 151
137 3300005201 Ga0072941_1539583 Ga0072941_15395831 153
138 3300038395 Ga0415639_028805 Ga0415639_028805_174_653 159

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07977 FabA FabA-like domain 11 131 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.