Protein Family IF07730
Metagenome
Isolate
189
Members
83
Samples
157
Scaffolds
433.43
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_253696|Ga0466715_253696_204_1733
- Length
- 509 aa
- Sequence
- LGQIARNKKNIEEEKIPCICLSEELTKKAGLPSQEKKYAIAGVPTMFLHKEFEKSPKNLAFRRLCGKMPACSILLSSHWNIKFMSVIFIKGGRVVDPSQNLDKVVNIRIANGKIEEIGVSVLPKPNDPVLNAQGKIVAPGLIDMHVHLREPGREEDETIETGTLAALHGGFTSVVCCPNTEPPLDSPGTLELVRQLANRAGNSNVYAMCCISKNREGKELAELGMLFQAGAVACSDDGSPVTDPELMRRALEYCLMFDKPALNHAESLPLTQGGVMHEGKVSMLLGLRGMPAAAEDVMVARDIALAELTGGRLHVMHLSTEHSVQTVRRAKERGVRVTAEVTPHHLTLTDEKLHSFNSNYKMNPPLRSQRHVEACLEGLRDGTIDVIATDHAPHALEKKMQEIDRAPFGIVGLETAVAALTTQLIHQGILTWTQLIEKTTLNPAKILGLPKGTLAVGADADITIIDPNRKWTVAESELHSKSKNSPYLGEELTGRVTAVILGGKLRYEK
Sample Types
Isolate
16.9%
Metagenome
83.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.5%
Unclassified
30.0%
Kalotermitidae
18.8%
Rhinotermitidae
3.8%
Scarabaeidae
3.8%
Termopsidae
3.8%
Passalidae
2.5%
Pyrrhocoridae
1.2%
Drosophilidae
1.2%
Elmidae
1.2%
Penaeidae
1.2%
Taxonomy
Archaea
0
Bacteria
185
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2778260936 | Unclassified Fibrobacteres Co191P3bin13 | Isolate | Unclassified |
| 2 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 11 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 12 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2820056190 | Unclassified Proteobacteria Nt197P4bin9 | Isolate | Unclassified |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 29 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 30 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 31 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 39 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 40 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 41 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 42 | 2820101058 | Unclassified Proteobacteria Emb289P4bin76 | Isolate | Unclassified |
| 43 | 2820196379 | Unclassified Planctomycetes Emb289P3bin158 | Isolate | Unclassified |
| 44 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 52 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 53 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 54 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 55 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 56 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 57 | 2778260935 | Unclassified Fibrobacteres Co191P1bin79 | Isolate | Unclassified |
| 58 | 2778260938 | Unclassified Fibrobacteres Co191P3bin71 | Isolate | Unclassified |
| 59 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 60 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 61 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 62 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 63 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 64 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 65 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 66 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 67 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 68 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 69 | 2820176377 | Unclassified Planctomycetes Th196P3bin111 | Isolate | Unclassified |
| 70 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 71 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 72 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 73 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 74 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 75 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 76 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 77 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 78 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 79 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 80 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 81 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 82 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 83 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_401114 | 3300042612 | Bacteria | 19120 |
| 2 | Ga0466712_226570 | 3300042614 | Bacteria | 2550 |
| 3 | Ga0466715_110155 | 3300042616 | Unclassified | 13321 |
| 4 | Ga0466715_306570 | 3300042616 | Bacteria | 5012 |
| 5 | Ga0466718_098855 | 3300042617 | Bacteria | 1978 |
| 6 | Ga0466723_171379 | 3300042618 | Bacteria | 3131 |
| 7 | Ga0466726_403132 | 3300042619 | Bacteria | 2135 |
| 8 | Ga0466700_437811 | 3300042600 | Bacteria | 57813 |
| 9 | Ga0466720_103416 | 3300042607 | Bacteria | 8642 |
| 10 | JGI24695J34938_10008030 | 3300002450 | Bacteria | 6084 |
| 11 | Ga0072940_1123873 | 3300005200 | Bacteria | 1653 |
| 12 | Ga0123357_10000029 | 3300009784 | Bacteria | 117460 |
| 13 | Ga0415639_117439 | 3300038395 | Bacteria | 4080 |
| 14 | Ga0466692_193979 | 3300042591 | Bacteria | 11960 |
| 15 | Ga0466691_015447 | 3300042593 | Unclassified | 4187 |
| 16 | Ga0466703_083242 | 3300042636 | Bacteria | 10930 |
| 17 | Ga0466703_179527 | 3300042636 | Bacteria | 4258 |
| 18 | Ga0466703_231112 | 3300042636 | Bacteria | 7741 |
| 19 | Ga0466709_275831 | 3300042648 | Bacteria | 12404 |
| 20 | Ga0123356_10003325 | 3300010049 | Bacteria | 16878 |
| 21 | Ga0123356_10034767 | 3300010049 | Bacteria | 4709 |
| 22 | Ga0123356_10071456 | 3300010049 | Bacteria | 3258 |
| 23 | Ga0123353_10033418 | 3300010167 | Bacteria | 8010 |
| 24 | Ga0123354_10216285 | 3300010882 | Bacteria | 2052 |
| 25 | Ga0466705_078858 | 3300042612 | Bacteria | 5018 |
| 26 | Ga0466715_451288 | 3300042616 | Bacteria | 48840 |
| 27 | Ga0466718_062537 | 3300042617 | Bacteria | 3903 |
| 28 | Ga0466723_123126 | 3300042618 | Bacteria | 36580 |
| 29 | Ga0466729_027460 | 3300042621 | Bacteria | 9030 |
| 30 | Ga0466717_131325 | 3300042604 | Bacteria | 7083 |
| 31 | IMNBL1DRAFT_c0000794 | 3300000062 | Bacteria | 24891 |
| 32 | AustNasuHG_c1000883 | 3300000089 | Bacteria | 10799 |
| 33 | JGI24695J34938_10000867 | 3300002450 | Bacteria | 27969 |
| 34 | JGI24702J35022_10001057 | 3300002462 | Bacteria | 17229 |
| 35 | JGI24697J35500_11272322 | 3300002507 | Bacteria | 4909 |
| 36 | Ga0072941_1039032 | 3300005201 | Bacteria | 6809 |
| 37 | Ga0072941_1337758 | 3300005201 | Bacteria | 1571 |
| 38 | Ga0074263_113320 | 3300005485 | Bacteria | 4165 |
| 39 | Ga0264413_131824 | 3300024493 | Bacteria | 7531 |
| 40 | Ga0415639_060693 | 3300038395 | Bacteria | 6670 |
| 41 | Ga0415639_105362 | 3300038395 | Bacteria | 4478 |
| 42 | Ga0466702_232813 | 3300042635 | Bacteria | 3158 |
| 43 | Ga0123355_10133005 | 3300009826 | Bacteria | 3827 |
| 44 | Ga0123356_10029733 | 3300010049 | Bacteria | 5114 |
| 45 | Ga0123356_10111817 | 3300010049 | Bacteria | 2640 |
| 46 | Ga0123353_10033587 | 3300010167 | Bacteria | 7992 |
| 47 | Ga0466705_215372 | 3300042612 | Bacteria | 4523 |
| 48 | Ga0466712_177484 | 3300042614 | Bacteria | 2162 |
| 49 | Ga0466723_062511 | 3300042618 | Bacteria | 7848 |
| 50 | Ga0466723_182232 | 3300042618 | Bacteria | 6448 |
| 51 | Ga0466707_294760 | 3300042601 | Bacteria | 2684 |
| 52 | Ga0466719_444044 | 3300042606 | Bacteria | 10643 |
| 53 | Ga0264413_109945 | 3300024493 | Bacteria | 10146 |
| 54 | Ga0466729_263011 | 3300042621 | Bacteria | 10410 |
| 55 | Ga0466704_358551 | 3300042643 | Bacteria | 22375 |
| 56 | Ga0466708_171006 | 3300042652 | Bacteria | 3335 |
| 57 | Ga0123355_10000830 | 3300009826 | Bacteria | 42395 |
| 58 | Ga0123355_10025588 | 3300009826 | Bacteria | 9504 |
| 59 | Ga0123356_10003510 | 3300010049 | Bacteria | 16410 |
| 60 | Ga0123353_10019109 | 3300010167 | Bacteria | 10166 |
| 61 | Ga0123353_10380702 | 3300010167 | Bacteria | 2110 |
| 62 | Ga0466732_000710 | 3300042656 | Bacteria | 21752 |
| 63 | Ga0466733_146416 | 3300042659 | Bacteria | 2652 |
| 64 | Ga0466711_027351 | 3300042615 | Bacteria | 3291 |
| 65 | Ga0466711_142851 | 3300042615 | Bacteria | 14058 |
| 66 | Ga0466715_253696 | 3300042616 | Bacteria | 16259 |
| 67 | Ga0466718_052906 | 3300042617 | Bacteria | 16214 |
| 68 | Ga0466700_364040 | 3300042600 | Bacteria | 2583 |
| 69 | Ga0466717_192384 | 3300042604 | Bacteria | 1587 |
| 70 | Ga0466720_071997 | 3300042607 | Bacteria | 33952 |
| 71 | JGI24702J35022_10023357 | 3300002462 | Bacteria | 3344 |
| 72 | Ga0068302_10329441 | 3300005071 | Bacteria | 2461 |
| 73 | Ga0072940_1045602 | 3300005200 | Bacteria | 17786 |
| 74 | Ga0072940_1078838 | 3300005200 | Bacteria | 2632 |
| 75 | Ga0072941_1005624 | 3300005201 | Bacteria | 5257 |
| 76 | Ga0466694_171370 | 3300042594 | Bacteria | 13075 |
| 77 | Ga0466696_239591 | 3300042596 | Bacteria | 7543 |
| 78 | Ga0466703_044830 | 3300042636 | Bacteria | 27157 |
| 79 | Ga0466704_150838 | 3300042643 | Unclassified | 2360 |
| 80 | Ga0466704_221757 | 3300042643 | Bacteria | 2736 |
| 81 | Ga0123353_10471386 | 3300010167 | Bacteria | 1841 |
| 82 | Ga0466705_501516 | 3300042612 | Bacteria | 35056 |
| 83 | Ga0466715_094645 | 3300042616 | Bacteria | 17875 |
| 84 | Ga0466723_308020 | 3300042618 | Bacteria | 2428 |
| 85 | Ga0466723_364777 | 3300042618 | Bacteria | 2612 |
| 86 | Ga0466726_331671 | 3300042619 | Bacteria | 20230 |
| 87 | Ga0466728_088732 | 3300042620 | Bacteria | 4436 |
| 88 | Ga0466728_233170 | 3300042620 | Bacteria | 14443 |
| 89 | Ga0466716_115915 | 3300042605 | Bacteria | 2821 |
| 90 | Ga0466721_098491 | 3300042608 | Bacteria | 36396 |
| 91 | Ga0466722_007630 | 3300042609 | Bacteria | 172426 |
| 92 | IMNBL1DRAFT_c0000409 | 3300000062 | Bacteria | 36350 |
| 93 | JGI24705J35276_12235248 | 3300002504 | Bacteria | 6334 |
| 94 | Ga0072940_1123872 | 3300005200 | Bacteria | 7719 |
| 95 | Ga0072941_1010570 | 3300005201 | Bacteria | 26105 |
| 96 | Ga0466690_045290 | 3300042590 | Unclassified | 9946 |
| 97 | Ga0466699_093316 | 3300042597 | Bacteria | 8165 |
| 98 | Ga0466731_092671 | 3300042622 | Bacteria | 36901 |
| 99 | Ga0466727_049025 | 3300042655 | Bacteria | 7519 |
| 100 | Ga0466727_197957 | 3300042655 | Bacteria | 9825 |
| 101 | Ga0123356_10002020 | 3300010049 | Bacteria | 21911 |
| 102 | Ga0123356_10025211 | 3300010049 | Bacteria | 5591 |
| 103 | Ga0123353_10018769 | 3300010167 | Bacteria | 10243 |
| 104 | Ga0123353_10193425 | 3300010167 | Bacteria | 3208 |
| 105 | Ga0123353_10239976 | 3300010167 | Bacteria | 2817 |
| 106 | Ga0123354_10142834 | 3300010882 | Bacteria | 2949 |
| 107 | Ga0466705_185592 | 3300042612 | Bacteria | 133507 |
| 108 | Ga0466718_002990 | 3300042617 | Bacteria | 5996 |
| 109 | Ga0466707_216943 | 3300042601 | Bacteria | 40737 |
| 110 | Ga0466716_404106 | 3300042605 | Bacteria | 3767 |
| 111 | Ga0466722_182680 | 3300042609 | Bacteria | 15473 |
| 112 | Ga0466692_158668 | 3300042591 | Bacteria | 509148 |
| 113 | Ga0466695_032723 | 3300042595 | Bacteria | 4000 |
| 114 | Ga0466695_117495 | 3300042595 | Bacteria | 3292 |
| 115 | Ga0466696_161491 | 3300042596 | Bacteria | 4409 |
| 116 | Ga0466699_179733 | 3300042597 | Bacteria | 4632 |
| 117 | Ga0466729_254474 | 3300042621 | Bacteria | 4472 |
| 118 | Ga0466702_196319 | 3300042635 | Bacteria | 2470 |
| 119 | Ga0466727_137062 | 3300042655 | Bacteria | 10058 |
| 120 | Ga0123353_10002980 | 3300010167 | Bacteria | 21196 |
| 121 | Ga0123353_10309543 | 3300010167 | Bacteria | 2405 |
| 122 | Ga0466733_138558 | 3300042659 | Bacteria | 1826 |
| 123 | Ga0466723_071572 | 3300042618 | Bacteria | 13890 |
| 124 | Ga0466723_197573 | 3300042618 | Bacteria | 17752 |
| 125 | 2227507950 | 2225789004 | Bacteria | 69912 |
| 126 | Ga0466690_296214 | 3300042590 | Bacteria | 1481 |
| 127 | Ga0466691_032255 | 3300042593 | Bacteria | 2978 |
| 128 | Ga0466695_063838 | 3300042595 | Bacteria | 1490 |
| 129 | Ga0466731_298296 | 3300042622 | Bacteria | 4147 |
| 130 | Ga0466704_470813 | 3300042643 | Bacteria | 5004 |
| 131 | Ga0466704_515737 | 3300042643 | Bacteria | 3030 |
| 132 | Ga0466708_223708 | 3300042652 | Bacteria | 3960 |
| 133 | Ga0123355_10022709 | 3300009826 | Bacteria | 10060 |
| 134 | Ga0123356_10005219 | 3300010049 | Bacteria | 13269 |
| 135 | Ga0123356_10043538 | 3300010049 | Bacteria | 4180 |
| 136 | Ga0123353_10000371 | 3300010167 | Bacteria | 55110 |
| 137 | Ga0123353_10001239 | 3300010167 | Bacteria | 31272 |
| 138 | Ga0123353_10057474 | 3300010167 | Bacteria | 6232 |
| 139 | Ga0123353_10147819 | 3300010167 | Bacteria | 3756 |
| 140 | Ga0123353_10642989 | 3300010167 | Bacteria | 1504 |
| 141 | Ga0466705_246380 | 3300042612 | Bacteria | 16264 |
| 142 | Ga0466711_098851 | 3300042615 | Bacteria | 6668 |
| 143 | Ga0466715_098535 | 3300042616 | Bacteria | 7051 |
| 144 | Ga0466718_122166 | 3300042617 | Bacteria | 5889 |
| 145 | Ga0466729_168303 | 3300042621 | Bacteria | 4980 |
| 146 | Ga0466700_236353 | 3300042600 | Bacteria | 3501 |
| 147 | Ga0466707_158200 | 3300042601 | Bacteria | 58881 |
| 148 | Ga0466696_312845 | 3300042596 | Bacteria | 1644 |
| 149 | Ga0466703_192393 | 3300042636 | Bacteria | 7319 |
| 150 | Ga0466703_278825 | 3300042636 | Bacteria | 2777 |
| 151 | Ga0466704_122517 | 3300042643 | Bacteria | 14278 |
| 152 | Ga0466704_494824 | 3300042643 | Bacteria | 4616 |
| 153 | Ga0466704_593861 | 3300042643 | Bacteria | 2645 |
| 154 | Ga0466704_607910 | 3300042643 | Bacteria | 9089 |
| 155 | Ga0466727_026844 | 3300042655 | Bacteria | 12823 |
| 156 | Ga0123356_10209038 | 3300010049 | Bacteria | 1998 |
| 157 | Ga0123353_10003853 | 3300010167 | Bacteria | 19142 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01979 | GO:0016787 | hydrolase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.