Protein Family IF07692
Metagenome
Isolate
125
Members
44
Samples
119
Scaffolds
350.37
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_189955|Ga0466715_189955_13736_14872
- Length
- 378 aa
- Sequence
- MEDFVTDIENIAEDAGFIEDQEDAFYEHFRFVADKGQNLLRVDKFLVDRIEHASRNRIQLAAGAGFILANGRPVKSNYKVKPNDLITVVMDRPRRELDIIPEDIPLPVVYEDDDVIVIDKPPGLVVHPGHGNYTGTLLNALAWYMKDKPGFDTDDPRLGLVHRIDKDTSGLLVVAKNPESKTNLGAQFFRKTTQRKYLALVWGNVKDNEGRIEGNIGRNPKDKLQMTVFTDGENGRHAVTHYRVLERFGYVTMIECRLETGRTHQIRVHLKHIGHTLFNDERYGGNEILKGNHTTKYKQFIRNCFEICPRQALHAQTLGFVHPKTGKEMFFESPLPEDIKGLIEKFKEYEEKYRNHSRRLFIRNCCLDEKRPGNTIFY
Sample Types
Isolate
4.8%
Metagenome
95.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
31.8%
Termitidae
29.5%
Unclassified
15.9%
Rhinotermitidae
9.1%
Passalidae
4.5%
Termopsidae
4.5%
Hodotermitidae
2.3%
Blattidae
2.3%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 20 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 28 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 29 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 32 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 33 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 34 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10006162 | 3300009784 | Bacteria | 14543 |
| 2 | Ga0123357_10222982 | 3300009784 | Bacteria | 2086 |
| 3 | Ga0123356_10181212 | 3300010049 | Bacteria | 2128 |
| 4 | Ga0123354_10001055 | 3300010882 | Bacteria | 31731 |
| 5 | Ga0123354_10003944 | 3300010882 | Bacteria | 20768 |
| 6 | Ga0466715_263547 | 3300042616 | Bacteria | 4883 |
| 7 | Ga0123357_10000101 | 3300009784 | Bacteria | 70940 |
| 8 | Ga0466735_050574 | 3300042624 | Bacteria | 1702 |
| 9 | Ga0466704_307788 | 3300042643 | Bacteria | 15366 |
| 10 | Ga0466707_098117 | 3300042601 | Unclassified | 4210 |
| 11 | Ga0466713_017528 | 3300042602 | Bacteria | 17038 |
| 12 | Ga0466722_046727 | 3300042609 | Bacteria | 1284 |
| 13 | Ga0466690_247349 | 3300042590 | Bacteria | 25016 |
| 14 | Ga0123357_10004643 | 3300009784 | Bacteria | 16204 |
| 15 | Ga0123357_10022878 | 3300009784 | Bacteria | 8387 |
| 16 | Ga0123357_10071588 | 3300009784 | Bacteria | 4597 |
| 17 | Ga0123354_10062435 | 3300010882 | Unclassified | 5485 |
| 18 | Ga0123354_10126893 | 3300010882 | Bacteria | 3252 |
| 19 | Ga0466715_189955 | 3300042616 | Bacteria | 18415 |
| 20 | JGI24702J35022_10001033 | 3300002462 | Bacteria | 17405 |
| 21 | JGI24702J35022_10009807 | 3300002462 | Bacteria | 5369 |
| 22 | JGI24699J35502_11131956 | 3300002509 | Bacteria | 6213 |
| 23 | JGI24699J35502_11133942 | 3300002509 | Bacteria | 20441 |
| 24 | Ga0466735_170604 | 3300042624 | Bacteria | 35167 |
| 25 | Ga0466703_037449 | 3300042636 | Bacteria | 1360 |
| 26 | Ga0466704_429455 | 3300042643 | Unclassified | 4032 |
| 27 | Ga0466727_122982 | 3300042655 | Bacteria | 40069 |
| 28 | Ga0466700_432608 | 3300042600 | Bacteria | 3389 |
| 29 | Ga0466707_033660 | 3300042601 | Bacteria | 25263 |
| 30 | Ga0466707_113516 | 3300042601 | Bacteria | 14148 |
| 31 | Ga0466716_357447 | 3300042605 | Bacteria | 3098 |
| 32 | Ga0466690_381813 | 3300042590 | Bacteria | 66142 |
| 33 | Ga0466692_099774 | 3300042591 | Bacteria | 51055 |
| 34 | Ga0466692_175276 | 3300042591 | Bacteria | 1855 |
| 35 | Ga0123357_10015473 | 3300009784 | Bacteria | 10002 |
| 36 | Ga0123357_10096578 | 3300009784 | Bacteria | 3826 |
| 37 | Ga0123354_10151307 | 3300010882 | Bacteria | 2810 |
| 38 | JGI24705J35276_12213745 | 3300002504 | Bacteria | 1935 |
| 39 | JGI24705J35276_12234530 | 3300002504 | Bacteria | 5612 |
| 40 | Ga0466729_264174 | 3300042621 | Bacteria | 4914 |
| 41 | Ga0466735_018201 | 3300042624 | Bacteria | 2936 |
| 42 | Ga0466701_036693 | 3300042598 | Bacteria | 31751 |
| 43 | Ga0466719_308788 | 3300042606 | Bacteria | 5630 |
| 44 | Ga0466690_205343 | 3300042590 | Bacteria | 7755 |
| 45 | Ga0466692_177107 | 3300042591 | Bacteria | 23256 |
| 46 | Ga0123354_10311030 | 3300010882 | Bacteria | 1471 |
| 47 | Ga0466715_400161 | 3300042616 | Bacteria | 8851 |
| 48 | 2227472152 | 2225789004 | Unclassified | 4818 |
| 49 | IMNBL1DRAFT_c0007061 | 3300000062 | Bacteria | 5983 |
| 50 | Ga0123357_10002736 | 3300009784 | Bacteria | 19873 |
| 51 | Ga0466705_045085 | 3300042612 | Bacteria | 9322 |
| 52 | Ga0466735_017066 | 3300042624 | Bacteria | 6211 |
| 53 | Ga0466735_221045 | 3300042624 | Unclassified | 2426 |
| 54 | Ga0466704_444884 | 3300042643 | Bacteria | 9544 |
| 55 | Ga0466701_091389 | 3300042598 | Bacteria | 105479 |
| 56 | Ga0466700_065731 | 3300042600 | Bacteria | 5367 |
| 57 | Ga0466714_017011 | 3300042603 | Bacteria | 20937 |
| 58 | Ga0466716_274033 | 3300042605 | Bacteria | 7183 |
| 59 | Ga0466723_152652 | 3300042618 | Bacteria | 5929 |
| 60 | Ga0466728_135541 | 3300042620 | Bacteria | 2869 |
| 61 | Ga0466705_056487 | 3300042612 | Bacteria | 11616 |
| 62 | Ga0466705_192801 | 3300042612 | Bacteria | 4036 |
| 63 | Ga0466709_378434 | 3300042648 | Bacteria | 7543 |
| 64 | Ga0466700_390206 | 3300042600 | Bacteria | 53046 |
| 65 | Ga0466707_331466 | 3300042601 | Bacteria | 9692 |
| 66 | Ga0466719_236977 | 3300042606 | Bacteria | 1799 |
| 67 | Ga0466722_201363 | 3300042609 | Bacteria | 3210 |
| 68 | Ga0466698_381079 | 3300042610 | Bacteria | 4326 |
| 69 | Ga0466690_077926 | 3300042590 | Bacteria | 4747 |
| 70 | Ga0123354_10000098 | 3300010882 | Bacteria | 64634 |
| 71 | Ga0123354_10001798 | 3300010882 | Bacteria | 27042 |
| 72 | Ga0123354_10186644 | 3300010882 | Unclassified | 2342 |
| 73 | Ga0466715_111272 | 3300042616 | Bacteria | 10912 |
| 74 | IMNBL1DRAFT_c0000956 | 3300000062 | Bacteria | 22304 |
| 75 | Ga0466697_135425 | 3300042611 | Bacteria | 2426 |
| 76 | Ga0466734_077524 | 3300042623 | Bacteria | 2490 |
| 77 | Ga0466703_092708 | 3300042636 | Bacteria | 10215 |
| 78 | Ga0466703_176430 | 3300042636 | Bacteria | 35435 |
| 79 | Ga0466708_053168 | 3300042652 | Bacteria | 12127 |
| 80 | Ga0466700_064176 | 3300042600 | Bacteria | 23341 |
| 81 | Ga0466719_116552 | 3300042606 | Bacteria | 3692 |
| 82 | Ga0466719_493339 | 3300042606 | Bacteria | 8624 |
| 83 | Ga0466722_000740 | 3300042609 | Bacteria | 3556 |
| 84 | Ga0466690_105531 | 3300042590 | Bacteria | 14462 |
| 85 | Ga0466691_049926 | 3300042593 | Bacteria | 11408 |
| 86 | Ga0466691_187837 | 3300042593 | Bacteria | 10413 |
| 87 | Ga0466696_092643 | 3300042596 | Bacteria | 9529 |
| 88 | Ga0123353_10518381 | 3300010167 | Bacteria | 1730 |
| 89 | Ga0123354_10002668 | 3300010882 | Bacteria | 23860 |
| 90 | Ga0466711_044131 | 3300042615 | Bacteria | 4750 |
| 91 | Ga0466729_167400 | 3300042621 | Bacteria | 7440 |
| 92 | IMNBL1DRAFT_c0000159 | 3300000062 | Bacteria | 59691 |
| 93 | Ga0123357_10002060 | 3300009784 | Bacteria | 22051 |
| 94 | Ga0466735_197533 | 3300042624 | Bacteria | 1528 |
| 95 | Ga0466704_161006 | 3300042643 | Bacteria | 10935 |
| 96 | Ga0466704_394722 | 3300042643 | Bacteria | 6803 |
| 97 | Ga0466707_087470 | 3300042601 | Bacteria | 2368 |
| 98 | Ga0466713_079678 | 3300042602 | Bacteria | 62372 |
| 99 | Ga0466719_075501 | 3300042606 | Bacteria | 2268 |
| 100 | Ga0466692_073863 | 3300042591 | Bacteria | 38781 |
| 101 | Ga0123357_10296644 | 3300009784 | Bacteria | 1641 |
| 102 | Ga0123353_10267574 | 3300010167 | Bacteria | 2636 |
| 103 | Ga0466711_253369 | 3300042615 | Bacteria | 6280 |
| 104 | Ga0466715_241115 | 3300042616 | Bacteria | 19169 |
| 105 | Ga0466715_469832 | 3300042616 | Bacteria | 3458 |
| 106 | Ga0466723_276128 | 3300042618 | Bacteria | 3505 |
| 107 | JGI24699J35502_11133414 | 3300002509 | Bacteria | 10407 |
| 108 | Ga0466705_158665 | 3300042612 | Bacteria | 18276 |
| 109 | Ga0466735_047137 | 3300042624 | Bacteria | 4945 |
| 110 | Ga0466735_115888 | 3300042624 | Bacteria | 4081 |
| 111 | Ga0466703_344396 | 3300042636 | Bacteria | 4476 |
| 112 | Ga0466704_175541 | 3300042643 | Bacteria | 41528 |
| 113 | Ga0466704_318489 | 3300042643 | Bacteria | 3320 |
| 114 | Ga0466706_249871 | 3300042599 | Bacteria | 3283 |
| 115 | Ga0466707_111993 | 3300042601 | Bacteria | 11357 |
| 116 | Ga0466707_199068 | 3300042601 | Bacteria | 14926 |
| 117 | Ga0466707_329671 | 3300042601 | Bacteria | 4250 |
| 118 | Ga0456237_0000403 | 3300041968 | Bacteria | 6524 |
| 119 | Ga0466690_013202 | 3300042590 | Bacteria | 28519 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00849 | PseudoU_synth_2 | RNA pseudouridylate synthase | 114 | 272 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.