Protein Family IF07691
Metagenome
Isolate
159
Members
67
Samples
134
Scaffolds
141.35
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_186828|Ga0466715_186828_4699_5172
- Length
- 157 aa
- Sequence
- MLPAHLSAFIYLSLHPMGRIMAIDYGRKRSGLAVTDTLQLIAGGLETVPSGKLVEYISDYVQREPVDRLIVGLPKQMNNEVSENMKYVEAFVTHLKRSIPGIPVQYYDERFTSVLAQRAMREGGLKKKKRQNKALTDKISAVIILQSYLESKKTTTI
Sample Types
Isolate
15.7%
Metagenome
84.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
29.9%
Termitidae
22.4%
Kalotermitidae
19.4%
Unclassified
7.5%
Rhinotermitidae
4.5%
Termopsidae
4.5%
Passalidae
4.5%
Hydrophilidae
3.0%
Drosophilidae
1.5%
Hodotermitidae
1.5%
Tenebrionidae
1.5%
Taxonomy
Archaea
0
Bacteria
155
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 2 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 3 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 4 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 14 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 20 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 21 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 29 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 30 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 31 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 32 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 33 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 38 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 41 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 44 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 45 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 46 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 49 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 50 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 51 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 52 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 53 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 54 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 55 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 56 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 57 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 58 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 59 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 60 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 61 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 62 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 63 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 64 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 65 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 66 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 67 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_057888 | 3300042612 | Bacteria | 11703 |
| 2 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 3 | Ga0466701_033217 | 3300042598 | Bacteria | 4314 |
| 4 | Ga0466719_237679 | 3300042606 | Bacteria | 1268 |
| 5 | Ga0466722_154973 | 3300042609 | Bacteria | 4247 |
| 6 | Ga0466690_402470 | 3300042590 | Bacteria | 7671 |
| 7 | Ga0466696_253210 | 3300042596 | Bacteria | 201850 |
| 8 | Ga0123356_12208463 | 3300010049 | Bacteria | 688 |
| 9 | Ga0466705_406286 | 3300042612 | Bacteria | 1021 |
| 10 | Ga0466711_039763 | 3300042615 | Bacteria | 11750 |
| 11 | Ga0466715_516781 | 3300042616 | Bacteria | 18003 |
| 12 | Ga0466715_642375 | 3300042616 | Bacteria | 8836 |
| 13 | Ga0466728_376933 | 3300042620 | Bacteria | 5387 |
| 14 | Ga0466729_166751 | 3300042621 | Bacteria | 2788 |
| 15 | Ga0466704_295144 | 3300042643 | Bacteria | 2935 |
| 16 | Ga0466727_150494 | 3300042655 | Unclassified | 4396 |
| 17 | Ga0466705_262482 | 3300042612 | Bacteria | 1380 |
| 18 | Ga0466705_326106 | 3300042612 | Bacteria | 40770 |
| 19 | Ga0466733_174129 | 3300042659 | Bacteria | 23754 |
| 20 | Ga0466719_173135 | 3300042606 | Bacteria | 1460 |
| 21 | Ga0466690_092197 | 3300042590 | Bacteria | 28749 |
| 22 | Ga0466690_333134 | 3300042590 | Bacteria | 14905 |
| 23 | Ga0466691_043152 | 3300042593 | Bacteria | 12747 |
| 24 | Ga0123357_10006062 | 3300009784 | Bacteria | 14634 |
| 25 | Ga0123357_10276420 | 3300009784 | Bacteria | 1744 |
| 26 | Ga0123353_10281216 | 3300010167 | Bacteria | 2555 |
| 27 | Ga0123353_12849769 | 3300010167 | Bacteria | 565 |
| 28 | Ga0466705_400119 | 3300042612 | Bacteria | 34089 |
| 29 | Ga0466711_408129 | 3300042615 | Bacteria | 10541 |
| 30 | Ga0466735_203942 | 3300042624 | Bacteria | 4108 |
| 31 | Ga0466700_255019 | 3300042600 | Bacteria | 1618 |
| 32 | Ga0466713_020992 | 3300042602 | Bacteria | 62959 |
| 33 | Ga0466716_195372 | 3300042605 | Bacteria | 22749 |
| 34 | Ga0466719_192586 | 3300042606 | Bacteria | 3451 |
| 35 | Ga0466722_253218 | 3300042609 | Bacteria | 1333 |
| 36 | 2227646845 | 2225789004 | Bacteria | 10925 |
| 37 | Ga0068305_10060045 | 3300005083 | Bacteria | 12737 |
| 38 | Ga0466696_127913 | 3300042596 | Bacteria | 17134 |
| 39 | Ga0123357_10289213 | 3300009784 | Bacteria | 1677 |
| 40 | Ga0466726_140263 | 3300042619 | Bacteria | 5015 |
| 41 | Ga0466729_081173 | 3300042621 | Bacteria | 2885 |
| 42 | Ga0466703_336099 | 3300042636 | Bacteria | 22653 |
| 43 | Ga0466704_345086 | 3300042643 | Bacteria | 6891 |
| 44 | Ga0466704_359414 | 3300042643 | Bacteria | 5731 |
| 45 | Ga0466709_180771 | 3300042648 | Bacteria | 2291 |
| 46 | Ga0466706_047388 | 3300042599 | Bacteria | 18343 |
| 47 | Ga0466713_006966 | 3300042602 | Bacteria | 26233 |
| 48 | Ga0466716_507390 | 3300042605 | Bacteria | 50325 |
| 49 | IMNBL1DRAFT_c0002014 | 3300000062 | Bacteria | 14560 |
| 50 | JGI24702J35022_10033559 | 3300002462 | Bacteria | 2746 |
| 51 | Ga0466690_059176 | 3300042590 | Bacteria | 2405 |
| 52 | Ga0123353_11355857 | 3300010167 | Bacteria | 918 |
| 53 | Ga0466715_563767 | 3300042616 | Bacteria | 24196 |
| 54 | Ga0466729_112099 | 3300042621 | Bacteria | 18792 |
| 55 | Ga0466703_071422 | 3300042636 | Bacteria | 20891 |
| 56 | Ga0466703_109020 | 3300042636 | Bacteria | 4584 |
| 57 | Ga0466704_245507 | 3300042643 | Bacteria | 3562 |
| 58 | Ga0466727_075374 | 3300042655 | Bacteria | 9191 |
| 59 | Ga0466706_163843 | 3300042599 | Bacteria | 10543 |
| 60 | Ga0466713_123312 | 3300042602 | Bacteria | 4668 |
| 61 | 2227222480 | 2225789004 | Bacteria | 7461 |
| 62 | Ga0104040_1144528 | 3300007149 | Bacteria | 1741 |
| 63 | Ga0466690_044253 | 3300042590 | Bacteria | 4682 |
| 64 | Ga0466696_137772 | 3300042596 | Bacteria | 7423 |
| 65 | Ga0123356_10019680 | 3300010049 | Bacteria | 6398 |
| 66 | Ga0123356_10490245 | 3300010049 | Bacteria | 1383 |
| 67 | Ga0123356_10684155 | 3300010049 | Bacteria | 1194 |
| 68 | Ga0123353_13147010 | 3300010167 | Bacteria | 530 |
| 69 | Ga0123354_10056511 | 3300010882 | Bacteria | 5859 |
| 70 | Ga0466715_047082 | 3300042616 | Bacteria | 54165 |
| 71 | Ga0466735_113870 | 3300042624 | Bacteria | 5300 |
| 72 | Ga0466735_191006 | 3300042624 | Bacteria | 1805 |
| 73 | Ga0466704_146857 | 3300042643 | Bacteria | 17615 |
| 74 | Ga0466706_280456 | 3300042599 | Bacteria | 15607 |
| 75 | Ga0466717_244571 | 3300042604 | Bacteria | 1261 |
| 76 | Ga0466716_349737 | 3300042605 | Bacteria | 18598 |
| 77 | Ga0466719_052340 | 3300042606 | Bacteria | 15916 |
| 78 | JGI24705J35276_12219717 | 3300002504 | Bacteria | 2221 |
| 79 | Ga0068305_10018409 | 3300005083 | Unclassified | 11089 |
| 80 | Ga0466696_300407 | 3300042596 | Bacteria | 4440 |
| 81 | Ga0123357_10683620 | 3300009784 | Bacteria | 743 |
| 82 | Ga0123356_10649873 | 3300010049 | Bacteria | 1222 |
| 83 | Ga0123353_11260526 | 3300010167 | Bacteria | 964 |
| 84 | Ga0466711_004876 | 3300042615 | Bacteria | 13509 |
| 85 | Ga0466711_025328 | 3300042615 | Bacteria | 13277 |
| 86 | Ga0466715_186828 | 3300042616 | Bacteria | 12554 |
| 87 | Ga0466715_386437 | 3300042616 | Bacteria | 19983 |
| 88 | Ga0466730_048250 | 3300042625 | Unclassified | 2464 |
| 89 | Ga0466703_387204 | 3300042636 | Bacteria | 10307 |
| 90 | Ga0466704_352259 | 3300042643 | Bacteria | 8413 |
| 91 | Ga0466709_412691 | 3300042648 | Bacteria | 4861 |
| 92 | Ga0466727_044747 | 3300042655 | Bacteria | 3248 |
| 93 | Ga0466733_120112 | 3300042659 | Bacteria | 197910 |
| 94 | Ga0466706_126051 | 3300042599 | Bacteria | 1779 |
| 95 | Ga0466706_192668 | 3300042599 | Bacteria | 87404 |
| 96 | Ga0466707_054277 | 3300042601 | Bacteria | 2595 |
| 97 | Ga0466707_358801 | 3300042601 | Bacteria | 2528 |
| 98 | Ga0466716_061788 | 3300042605 | Bacteria | 14272 |
| 99 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 100 | 2227035914 | 2225789003 | Bacteria | 20618 |
| 101 | 2227477412 | 2225789004 | Bacteria | 22379 |
| 102 | 2227482969 | 2225789004 | Bacteria | 21843 |
| 103 | JGI24702J35022_10125593 | 3300002462 | Bacteria | 1420 |
| 104 | JGI24696J40584_12606662 | 3300002834 | Bacteria | 661 |
| 105 | Ga0068305_10069228 | 3300005083 | Bacteria | 15642 |
| 106 | Ga0466690_029345 | 3300042590 | Bacteria | 8622 |
| 107 | Ga0466690_292067 | 3300042590 | Bacteria | 2394 |
| 108 | Ga0466691_082783 | 3300042593 | Bacteria | 28065 |
| 109 | Ga0466694_251173 | 3300042594 | Bacteria | 1707 |
| 110 | Ga0123357_10592070 | 3300009784 | Bacteria | 857 |
| 111 | Ga0123353_10362377 | 3300010167 | Bacteria | 2178 |
| 112 | Ga0123353_10420174 | 3300010167 | Bacteria | 1981 |
| 113 | Ga0466715_397790 | 3300042616 | Bacteria | 5427 |
| 114 | Ga0466726_284900 | 3300042619 | Bacteria | 1475 |
| 115 | Ga0466735_168994 | 3300042624 | Bacteria | 1129 |
| 116 | Ga0466703_160950 | 3300042636 | Bacteria | 8217 |
| 117 | Ga0466703_214432 | 3300042636 | Bacteria | 3316 |
| 118 | Ga0466704_084380 | 3300042643 | Bacteria | 14804 |
| 119 | Ga0466704_119527 | 3300042643 | Bacteria | 22827 |
| 120 | Ga0466709_419248 | 3300042648 | Bacteria | 2668 |
| 121 | Ga0466705_198378 | 3300042612 | Bacteria | 14888 |
| 122 | Ga0466705_274599 | 3300042612 | Bacteria | 1117 |
| 123 | Ga0466733_070581 | 3300042659 | Bacteria | 40188 |
| 124 | Ga0466713_026688 | 3300042602 | Bacteria | 1635 |
| 125 | 2227149976 | 2225789004 | Unclassified | 1592 |
| 126 | IMNBL1DRAFT_c0001868 | 3300000062 | Bacteria | 15333 |
| 127 | JGI24705J35276_12238425 | 3300002504 | Bacteria | 21658 |
| 128 | JGI24696J40584_12881119 | 3300002834 | Bacteria | 1085 |
| 129 | Ga0466656_170778 | 3300042550 | Bacteria | 1524 |
| 130 | Ga0466696_117205 | 3300042596 | Bacteria | 2332 |
| 131 | Ga0466711_222547 | 3300042615 | Bacteria | 19633 |
| 132 | Ga0466723_086277 | 3300042618 | Bacteria | 16197 |
| 133 | Ga0466723_193043 | 3300042618 | Bacteria | 34490 |
| 134 | Ga0466728_415375 | 3300042620 | Bacteria | 16610 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03652 | RuvX | Holliday junction resolvase | 19 | 150 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03652 | GO:0006364 | rRNA processing | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.