Protein Family IF07671
Metagenome
Isolate
112
Members
53
Samples
105
Scaffolds
279.61
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_136727|Ga0466715_136727_14997_15944
- Length
- 315 aa
- Sequence
- MFFNQKDLPGVFLSCIFAVFYFTNTLILIVCFMDAIHLRNVDFSYSNKAKLLSNVSLQIPSGHIHGLLGKNGEGKSTLLKLIAGLLFPQKGAVDVLAFEPRKRHPEMLRDIYFLSEELPVSTLSIAGFEKVYAPFYPNFSAEQFENHLKEFDILSKNWKMNQLSHGQKKKVIVAFALATRTKILLMDEPTNGLDIPSKGQFRRMAASALEEERCIIISTHQVRDLDSLIDTIIIMDEHEIVINESIDTITDRLLFRVKETNEPDDTVIHSEDTLRGIYQVCENRMHEDSKLDIELLFNSVYINKKRIQQIFHPQA
Sample Types
Isolate
6.2%
Metagenome
93.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.1%
Kalotermitidae
23.1%
Unclassified
13.5%
Rhinotermitidae
5.8%
Termopsidae
5.8%
Elmidae
1.9%
Hodotermitidae
1.9%
Taxonomy
Archaea
1
Bacteria
102
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 3 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 4 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 5 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 6 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 7 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 17 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 18 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 19 | 2820786992 | Unclassified Bacteroidetes Emb289P1bin66 | Isolate | Unclassified |
| 20 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 21 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 29 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 33 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 34 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 44 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 45 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 46 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 47 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 48 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 49 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 50 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 51 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 52 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 53 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_238662 | 3300042611 | Bacteria | 1522 |
| 2 | Ga0123357_10050352 | 3300009784 | Bacteria | 5639 |
| 3 | Ga0123354_10528777 | 3300010882 | Bacteria | 901 |
| 4 | Ga0466700_222923 | 3300042600 | Bacteria | 2368 |
| 5 | Ga0466717_097982 | 3300042604 | Bacteria | 1818 |
| 6 | Ga0466722_135316 | 3300042609 | Bacteria | 14045 |
| 7 | Ga0466735_158984 | 3300042624 | Archaea | 2229 |
| 8 | Ga0466704_488602 | 3300042643 | Bacteria | 43344 |
| 9 | Ga0466709_304600 | 3300042648 | Bacteria | 78097 |
| 10 | JGI24702J35022_10189998 | 3300002462 | Unclassified | 1171 |
| 11 | Ga0466705_273206 | 3300042612 | Bacteria | 5248 |
| 12 | Ga0466733_209000 | 3300042659 | Bacteria | 10317 |
| 13 | Ga0123355_10000377 | 3300009826 | Bacteria | 57341 |
| 14 | Ga0466694_056450 | 3300042594 | Bacteria | 1169 |
| 15 | Ga0466710_335481 | 3300042613 | Bacteria | 1301 |
| 16 | Ga0466707_097713 | 3300042601 | Bacteria | 6083 |
| 17 | Ga0466713_114273 | 3300042602 | Bacteria | 7383 |
| 18 | Ga0466716_081862 | 3300042605 | Bacteria | 6179 |
| 19 | JGI24702J35022_10011270 | 3300002462 | Bacteria | 4985 |
| 20 | JGI24702J35022_10015129 | 3300002462 | Unclassified | 4250 |
| 21 | JGI24705J35276_12238714 | 3300002504 | Bacteria | 41533 |
| 22 | Ga0466697_264335 | 3300042611 | Bacteria | 1271 |
| 23 | Ga0123357_10128134 | 3300009784 | Unclassified | 3171 |
| 24 | Ga0123357_10226552 | 3300009784 | Bacteria | 2060 |
| 25 | Ga0123356_10003932 | 3300010049 | Bacteria | 15461 |
| 26 | Ga0123353_10345330 | 3300010167 | Bacteria | 2246 |
| 27 | Ga0123354_10148309 | 3300010882 | Bacteria | 2858 |
| 28 | Ga0123354_10338349 | 3300010882 | Unclassified | 1360 |
| 29 | Ga0466693_243380 | 3300042592 | Unclassified | 1394 |
| 30 | Ga0466696_253210 | 3300042596 | Bacteria | 201850 |
| 31 | Ga0466706_012634 | 3300042599 | Bacteria | 153886 |
| 32 | Ga0466722_154127 | 3300042609 | Bacteria | 3378 |
| 33 | JGI24695J34938_10018608 | 3300002450 | Bacteria | 3466 |
| 34 | Ga0123356_10216663 | 3300010049 | Bacteria | 1968 |
| 35 | Ga0466656_219515 | 3300042550 | Bacteria | 1311 |
| 36 | Ga0466657_067335 | 3300042582 | Bacteria | 1084 |
| 37 | Ga0466710_102087 | 3300042613 | Bacteria | 1969 |
| 38 | Ga0466715_270392 | 3300042616 | Bacteria | 3485 |
| 39 | Ga0466726_453058 | 3300042619 | Bacteria | 2499 |
| 40 | Ga0466726_487296 | 3300042619 | Bacteria | 1423 |
| 41 | Ga0466707_336506 | 3300042601 | Bacteria | 13223 |
| 42 | Ga0466729_286015 | 3300042621 | Bacteria | 2826 |
| 43 | JGI24702J35022_10011057 | 3300002462 | Bacteria | 5029 |
| 44 | JGI24702J35022_10022742 | 3300002462 | Bacteria | 3390 |
| 45 | JGI24705J35276_12223627 | 3300002504 | Bacteria | 2528 |
| 46 | JGI24699J35502_11134176 | 3300002509 | Bacteria | 44830 |
| 47 | JGI24696J40584_12908695 | 3300002834 | Bacteria | 1238 |
| 48 | Ga0072940_1366001 | 3300005200 | Unclassified | 1632 |
| 49 | Ga0123355_10038713 | 3300009826 | Unclassified | 7755 |
| 50 | Ga0123355_10407358 | 3300009826 | Bacteria | 1748 |
| 51 | Ga0123354_10034291 | 3300010882 | Bacteria | 7937 |
| 52 | Ga0123354_10059315 | 3300010882 | Bacteria | 5676 |
| 53 | Ga0466656_333717 | 3300042550 | Bacteria | 2664 |
| 54 | Ga0466692_030815 | 3300042591 | Bacteria | 2687 |
| 55 | Ga0466692_096157 | 3300042591 | Bacteria | 46268 |
| 56 | Ga0466693_065400 | 3300042592 | Bacteria | 2329 |
| 57 | Ga0466693_167541 | 3300042592 | Bacteria | 2314 |
| 58 | Ga0466693_274971 | 3300042592 | Bacteria | 1714 |
| 59 | Ga0466695_235673 | 3300042595 | Bacteria | 18098 |
| 60 | Ga0466710_388284 | 3300042613 | Bacteria | 2250 |
| 61 | Ga0466711_120016 | 3300042615 | Bacteria | 45710 |
| 62 | Ga0466715_136727 | 3300042616 | Bacteria | 19915 |
| 63 | Ga0466703_211370 | 3300042636 | Bacteria | 13641 |
| 64 | Ga0466727_065124 | 3300042655 | Bacteria | 8528 |
| 65 | JGI24699J35502_11133753 | 3300002509 | Bacteria | 14839 |
| 66 | JGI24696J40584_12938262 | 3300002834 | Bacteria | 1623 |
| 67 | Ga0466697_230860 | 3300042611 | Bacteria | 1531 |
| 68 | Ga0123356_10413262 | 3300010049 | Bacteria | 1489 |
| 69 | Ga0123354_10006605 | 3300010882 | Bacteria | 17272 |
| 70 | Ga0123354_10189322 | 3300010882 | Bacteria | 2311 |
| 71 | Ga0123354_10351042 | 3300010882 | Bacteria | 1315 |
| 72 | Ga0466656_218745 | 3300042550 | Bacteria | 1609 |
| 73 | Ga0466722_170506 | 3300042609 | Bacteria | 35958 |
| 74 | Ga0466704_367215 | 3300042643 | Bacteria | 17146 |
| 75 | Ga0466708_117679 | 3300042652 | Bacteria | 7238 |
| 76 | Ga0466725_354452 | 3300042654 | Bacteria | 36195 |
| 77 | Ga0466727_130401 | 3300042655 | Bacteria | 9305 |
| 78 | JGI24705J35276_12229445 | 3300002504 | Bacteria | 3390 |
| 79 | Ga0466733_138276 | 3300042659 | Bacteria | 3939 |
| 80 | Ga0264413_156867 | 3300024493 | Bacteria | 2073 |
| 81 | Ga0466692_046708 | 3300042591 | Bacteria | 150257 |
| 82 | Ga0466694_168071 | 3300042594 | Bacteria | 1432 |
| 83 | Ga0466728_226945 | 3300042620 | Bacteria | 1746 |
| 84 | Ga0466728_402665 | 3300042620 | Bacteria | 5162 |
| 85 | Ga0466701_062330 | 3300042598 | Bacteria | 1093 |
| 86 | Ga0466707_108713 | 3300042601 | Bacteria | 5417 |
| 87 | Ga0466707_248541 | 3300042601 | Bacteria | 9831 |
| 88 | Ga0466735_165300 | 3300042624 | Bacteria | 1548 |
| 89 | Ga0466704_185825 | 3300042643 | Unclassified | 2821 |
| 90 | Ga0466725_363657 | 3300042654 | Bacteria | 2012 |
| 91 | JGI24695J34938_10045252 | 3300002450 | Bacteria | 1953 |
| 92 | Ga0123353_10363828 | 3300010167 | Bacteria | 2172 |
| 93 | Ga0123354_10007267 | 3300010882 | Bacteria | 16630 |
| 94 | Ga0123354_10238944 | 3300010882 | Bacteria | 1875 |
| 95 | Ga0466710_450432 | 3300042613 | Bacteria | 1173 |
| 96 | Ga0466713_022399 | 3300042602 | Bacteria | 26526 |
| 97 | Ga0466719_179996 | 3300042606 | Bacteria | 5006 |
| 98 | Ga0466729_202694 | 3300042621 | Unclassified | 2252 |
| 99 | Ga0466731_066192 | 3300042622 | Bacteria | 1767 |
| 100 | Ga0466734_042963 | 3300042623 | Bacteria | 1725 |
| 101 | Ga0466703_262364 | 3300042636 | Bacteria | 17940 |
| 102 | JGI24702J35022_10005633 | 3300002462 | Bacteria | 7299 |
| 103 | JGI24705J35276_12233496 | 3300002504 | Bacteria | 4871 |
| 104 | JGI24699J35502_11086544 | 3300002509 | Bacteria | 2059 |
| 105 | JGI24696J40584_12952061 | 3300002834 | Bacteria | 2305 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 52 | 191 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.