Protein Family IF07643
Metagenome
Isolate
136
Members
54
Samples
124
Scaffolds
119.24
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_083268|Ga0466715_083268_4269_4688
- Length
- 139 aa
- Sequence
- MHNAQLMMHNNLGGWSAMKNDNVIEIKSKAFAIRIVRLYQYLSEQKKEFILSRQLLKSGTSIGANIKEAIRGQSKADFVAKMNIALKESSETEYWLEILHETSYIDEAEYSGIYADNKELLKMLTSIIKTAKTNNPALN
Sample Types
Isolate
8.8%
Metagenome
91.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.5%
Unclassified
18.9%
Kalotermitidae
18.9%
Elmidae
5.7%
Termopsidae
3.8%
Passalidae
3.8%
Rhinotermitidae
3.8%
Tenebrionidae
1.9%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
131
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 2 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 3 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 9 | 2820727601 | Unclassified Cloacimonetes Nt197P3bin46 | Isolate | Unclassified |
| 10 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 11 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 12 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 13 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 14 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 15 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 16 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 17 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 27 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 28 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 29 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 30 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 35 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 41 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 42 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 45 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 46 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 47 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 48 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 49 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 50 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 51 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 52 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 53 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 54 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_200358 | 3300042611 | Bacteria | 7852 |
| 2 | Ga0466704_529437 | 3300042643 | Unclassified | 1141 |
| 3 | Ga0466704_570337 | 3300042643 | Bacteria | 1282 |
| 4 | Ga0466725_250862 | 3300042654 | Bacteria | 1477 |
| 5 | Ga0466717_289045 | 3300042604 | Bacteria | 1242 |
| 6 | Ga0466722_090301 | 3300042609 | Bacteria | 39569 |
| 7 | Ga0123355_10699257 | 3300009826 | Bacteria | 1165 |
| 8 | Ga0123355_11678061 | 3300009826 | Bacteria | 607 |
| 9 | Ga0123356_10353861 | 3300010049 | Bacteria | 1593 |
| 10 | Ga0123356_10523585 | 3300010049 | Bacteria | 1344 |
| 11 | Ga0123356_10596796 | 3300010049 | Bacteria | 1269 |
| 12 | Ga0123356_13631543 | 3300010049 | Bacteria | 534 |
| 13 | Ga0123353_10417394 | 3300010167 | Bacteria | 1990 |
| 14 | Ga0123353_12764156 | 3300010167 | Bacteria | 576 |
| 15 | Ga0123354_10686800 | 3300010882 | Bacteria | 720 |
| 16 | Ga0466711_354091 | 3300042615 | Bacteria | 27845 |
| 17 | IMNBL1DRAFT_c0131666 | 3300000062 | Bacteria | 651 |
| 18 | Ga0466732_427564 | 3300042656 | Bacteria | 1900 |
| 19 | Ga0466707_369109 | 3300042601 | Bacteria | 4696 |
| 20 | Ga0466713_093828 | 3300042602 | Bacteria | 79343 |
| 21 | Ga0466720_106006 | 3300042607 | Bacteria | 1782 |
| 22 | Ga0466722_210066 | 3300042609 | Bacteria | 1771 |
| 23 | Ga0415639_131905 | 3300038395 | Bacteria | 5334 |
| 24 | Ga0466691_228505 | 3300042593 | Bacteria | 5656 |
| 25 | Ga0466694_180103 | 3300042594 | Bacteria | 1029 |
| 26 | Ga0123357_10830775 | 3300009784 | Bacteria | 616 |
| 27 | Ga0123356_10804918 | 3300010049 | Bacteria | 1111 |
| 28 | Ga0123356_10860313 | 3300010049 | Bacteria | 1078 |
| 29 | Ga0123353_12062416 | 3300010167 | Bacteria | 696 |
| 30 | Ga0123353_13386652 | 3300010167 | Bacteria | 506 |
| 31 | JGI24702J35022_10026130 | 3300002462 | Bacteria | 3146 |
| 32 | JGI24696J40584_12862179 | 3300002834 | Bacteria | 1015 |
| 33 | Ga0466707_105690 | 3300042601 | Bacteria | 2057 |
| 34 | Ga0466694_030584 | 3300042594 | Bacteria | 71743 |
| 35 | Ga0466694_206417 | 3300042594 | Bacteria | 1743 |
| 36 | Ga0466701_005644 | 3300042598 | Bacteria | 1141 |
| 37 | Ga0123355_10897502 | 3300009826 | Bacteria | 964 |
| 38 | Ga0123356_10000495 | 3300010049 | Bacteria | 43925 |
| 39 | Ga0123356_10544498 | 3300010049 | Bacteria | 1321 |
| 40 | Ga0123356_13095124 | 3300010049 | Bacteria | 580 |
| 41 | Ga0123353_10218646 | 3300010167 | Bacteria | 2982 |
| 42 | Ga0466705_420380 | 3300042612 | Bacteria | 591368 |
| 43 | Ga0466711_198755 | 3300042615 | Bacteria | 6542 |
| 44 | Ga0466726_118049 | 3300042619 | Bacteria | 2276 |
| 45 | Ga0466728_448576 | 3300042620 | Bacteria | 1536 |
| 46 | JGI24702J35022_10492201 | 3300002462 | Bacteria | 751 |
| 47 | Ga0466708_028821 | 3300042652 | Bacteria | 1073 |
| 48 | Ga0466725_194629 | 3300042654 | Bacteria | 1052 |
| 49 | Ga0466725_395469 | 3300042654 | Bacteria | 1502 |
| 50 | Ga0466714_055854 | 3300042603 | Bacteria | 7265 |
| 51 | Ga0123356_11717838 | 3300010049 | Bacteria | 779 |
| 52 | Ga0123353_12037846 | 3300010167 | Bacteria | 701 |
| 53 | Ga0123353_12518591 | 3300010167 | Bacteria | 611 |
| 54 | Ga0123353_12534394 | 3300010167 | Bacteria | 609 |
| 55 | Ga0466711_119595 | 3300042615 | Bacteria | 2880 |
| 56 | IMNBL1DRAFT_c0001642 | 3300000062 | Bacteria | 16565 |
| 57 | Ga0466657_108155 | 3300042582 | Unclassified | 1005 |
| 58 | Ga0466694_262175 | 3300042594 | Bacteria | 2061 |
| 59 | Ga0123355_11755610 | 3300009826 | Bacteria | 588 |
| 60 | Ga0123356_10239988 | 3300010049 | Bacteria | 1883 |
| 61 | Ga0123356_11925383 | 3300010049 | Bacteria | 736 |
| 62 | Ga0123356_13939955 | 3300010049 | Bacteria | 512 |
| 63 | Ga0123353_10626798 | 3300010167 | Bacteria | 1529 |
| 64 | Ga0123353_11138026 | 3300010167 | Bacteria | 1032 |
| 65 | Ga0123353_11874111 | 3300010167 | Bacteria | 741 |
| 66 | Ga0466710_248927 | 3300042613 | Bacteria | 1184 |
| 67 | Ga0466726_496840 | 3300042619 | Bacteria | 1097 |
| 68 | Ga0072941_1001384 | 3300005201 | Bacteria | 24386 |
| 69 | Ga0466716_106657 | 3300042605 | Bacteria | 3885 |
| 70 | Ga0466722_166055 | 3300042609 | Bacteria | 2996 |
| 71 | Ga0466690_423497 | 3300042590 | Bacteria | 4921 |
| 72 | Ga0466692_054940 | 3300042591 | Bacteria | 1703 |
| 73 | Ga0123355_11764555 | 3300009826 | Bacteria | 586 |
| 74 | Ga0123353_10330571 | 3300010167 | Bacteria | 2307 |
| 75 | Ga0123353_12199846 | 3300010167 | Bacteria | 667 |
| 76 | Ga0123353_12587331 | 3300010167 | Bacteria | 601 |
| 77 | Ga0123353_13049389 | 3300010167 | Bacteria | 541 |
| 78 | Ga0466711_000573 | 3300042615 | Bacteria | 1723 |
| 79 | 2227612960 | 2225789004 | Bacteria | 2246 |
| 80 | Ga0466727_194451 | 3300042655 | Bacteria | 1828 |
| 81 | Ga0466701_094798 | 3300042598 | Bacteria | 3701 |
| 82 | Ga0466706_268122 | 3300042599 | Bacteria | 4478 |
| 83 | Ga0466706_288172 | 3300042599 | Bacteria | 2535 |
| 84 | Ga0466717_016985 | 3300042604 | Bacteria | 2728 |
| 85 | Ga0466719_484705 | 3300042606 | Bacteria | 1866 |
| 86 | Ga0466693_044602 | 3300042592 | Bacteria | 2650 |
| 87 | Ga0466699_218471 | 3300042597 | Bacteria | 1052 |
| 88 | Ga0123355_10683063 | 3300009826 | Bacteria | 1185 |
| 89 | Ga0123356_10000211 | 3300010049 | Bacteria | 67882 |
| 90 | Ga0123356_10256305 | 3300010049 | Bacteria | 1830 |
| 91 | Ga0123356_11795336 | 3300010049 | Bacteria | 762 |
| 92 | Ga0123353_10042992 | 3300010167 | Bacteria | 7154 |
| 93 | Ga0123353_10053487 | 3300010167 | Bacteria | 6453 |
| 94 | Ga0123353_11166571 | 3300010167 | Bacteria | 1015 |
| 95 | Ga0123353_12928579 | 3300010167 | Unclassified | 555 |
| 96 | Ga0123354_10063733 | 3300010882 | Bacteria | 5413 |
| 97 | Ga0123354_10423408 | 3300010882 | Bacteria | 1104 |
| 98 | Ga0466715_083268 | 3300042616 | Bacteria | 19048 |
| 99 | Ga0466715_596746 | 3300042616 | Bacteria | 1074 |
| 100 | JGI24702J35022_10081805 | 3300002462 | Bacteria | 1750 |
| 101 | Ga0466705_273630 | 3300042612 | Unclassified | 1052 |
| 102 | Ga0466704_546040 | 3300042643 | Bacteria | 2214 |
| 103 | Ga0466707_319236 | 3300042601 | Bacteria | 1402 |
| 104 | Ga0466707_357853 | 3300042601 | Bacteria | 11546 |
| 105 | Ga0466714_051352 | 3300042603 | Bacteria | 1824 |
| 106 | Ga0466716_241352 | 3300042605 | Bacteria | 3125 |
| 107 | Ga0466722_091878 | 3300042609 | Bacteria | 1602 |
| 108 | Ga0466657_158231 | 3300042582 | Bacteria | 3203 |
| 109 | Ga0466692_201741 | 3300042591 | Bacteria | 2359 |
| 110 | Ga0466694_282815 | 3300042594 | Bacteria | 1270 |
| 111 | Ga0466695_205123 | 3300042595 | Bacteria | 5312 |
| 112 | Ga0123357_10330254 | 3300009784 | Bacteria | 1491 |
| 113 | Ga0123355_10027918 | 3300009826 | Bacteria | 9121 |
| 114 | Ga0123356_10262055 | 3300010049 | Bacteria | 1813 |
| 115 | Ga0123356_12221152 | 3300010049 | Bacteria | 686 |
| 116 | Ga0123353_10001991 | 3300010167 | Bacteria | 25237 |
| 117 | Ga0123353_10848208 | 3300010167 | Bacteria | 1253 |
| 118 | Ga0123353_11960311 | 3300010167 | Bacteria | 719 |
| 119 | Ga0123353_12678687 | 3300010167 | Bacteria | 588 |
| 120 | Ga0123354_10785083 | 3300010882 | Bacteria | 645 |
| 121 | JGI24695J34938_10070686 | 3300002450 | Bacteria | 1460 |
| 122 | JGI24702J35022_10595587 | 3300002462 | Bacteria | 684 |
| 123 | JGI24702J35022_10679400 | 3300002462 | Unclassified | 639 |
| 124 | Ga0072941_1009033 | 3300005201 | Bacteria | 8786 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05635 | 23S_rRNA_IVP | 23S rRNA-intervening sequence protein | 26 | 126 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.