Protein Family IF07616

Metagenome Isolate
273 Members
95 Samples
227 Scaffolds
435.75 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_033725|Ga0466715_033725_33863_35359
Length
490 aa
Sequence
MTTENPDVLAAPDGGSTGNIYFRLVILFILILVNAFFAMSEIAIISLNDNKIDKLAGEGHKKARQILRLTANSSGFLSTIQIGVTLAGFLTSASAAEFFSPILANAFVGWFPALAGYETTIGTLSLVLVTLIMSYFSLVLGELVPKRIAMQKAEKVSYAVVGVLLFINKITTPFVKILSLSTNGVIRLIGLDPNADEEQVTEEEILMMVDVGEEKGVIENAQREMINNIFEFDDIDAGDIMTHRVDITAVEADEPVSEVVKAAIEDGYSRIPVYDDDPDNIVGIVYIKDLLKYIGQDMPTDTTIRYIMREAYFVPETKRCGELFNEMIEKHMQMAIIIDEFGGTAGLVTIEDLVEAIVGNIQDEYQINDSTFTVDGVTDIEEVDDLVGAALPEGDYDTIGGFIISQLGYLPVDGDLDIVTYENLIFTVLSVEDRRIGKIKIEILPRNEEGSHEKTKKEDAKDKPSEKKRAGKQRFEENAKAMRAADAAAE

πŸ“Š Sample Types

Isolate 16.9%
Metagenome 83.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 25.0%
Termitidae 25.0%
Kalotermitidae 16.3%
Blattidae 7.6%
Rhinotermitidae 4.3%
Termopsidae 4.3%
Scarabaeidae 3.3%
Apidae 2.2%
Passalidae 2.2%
Drosophilidae 1.1%
Armadillidiidae 1.1%
Elmidae 1.1%
Blaberidae 1.1%
Thomisidae 1.1%
Tenebrionidae 1.1%
Hodotermitidae 1.1%
Cambaridae 1.1%
Reduviidae 1.1%

🌳 Taxonomy

Archaea 2
Bacteria 258
Eukaryota 0
Viruses 0
Unclassified 13

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2931425734 Nocardioides sp. J2M5 Isolate
2 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
3 2518645556 Nocardiopsis alba ATCC BAA-2165 Isolate Apidae
4 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
5 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
6 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
7 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
8 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
9 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
10 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
11 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
12 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 2904728850 Flavobacterium sp. xlx-214 Isolate
16 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
17 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
18 2590828840 Clostridium sp. 2 Isolate Termitidae
19 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
20 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
21 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
22 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
23 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
32 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
33 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
34 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
35 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
36 2772190975 Treponema sp. RmG30 Isolate Blaberidae
37 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
38 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
41 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
42 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
43 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
44 2590828839 Clostridium sp. 1 Isolate Termitidae
45 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
46 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
47 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
48 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
49 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
50 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
51 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
52 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
53 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
54 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
55 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
56 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
57 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
58 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
59 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
60 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
61 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
62 2508501043 Desulfovibrio termitidis HI1 Isolate Rhinotermitidae
63 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
64 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
65 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
66 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
67 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
68 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
69 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
70 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
71 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
72 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
73 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
74 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
75 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
76 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
77 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
78 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
79 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
80 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
81 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
82 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
83 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
84 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
85 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
86 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
87 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
88 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
89 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
90 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
91 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
92 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
93 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
94 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
95 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_153241 3300042612 Bacteria 8109
2 Ga0466705_177216 3300042612 Bacteria 7950
3 Ga0466712_103448 3300042614 Bacteria 2764
4 Ga0466711_132222 3300042615 Bacteria 15378
5 Ga0466711_186806 3300042615 Bacteria 11166
6 Ga0466715_017964 3300042616 Bacteria 22310
7 Ga0466723_157815 3300042618 Unclassified 5666
8 Ga0068305_10003993 3300005083 Bacteria 109457
9 Ga0466707_064956 3300042601 Bacteria 8476
10 Ga0466716_274193 3300042605 Bacteria 3321
11 Ga0466690_070460 3300042590 Bacteria 2647
12 Ga0466690_150714 3300042590 Bacteria 5109
13 Ga0466692_091867 3300042591 Bacteria 17888
14 Ga0466692_127384 3300042591 Bacteria 123881
15 Ga0466696_018162 3300042596 Bacteria 10656
16 Ga0466696_189040 3300042596 Bacteria 11391
17 Ga0466696_194009 3300042596 Bacteria 2088
18 Ga0123355_10000163 3300009826 Bacteria 81520
19 Ga0123353_10000339 3300010167 Bacteria 57571
20 Ga0466703_145457 3300042636 Bacteria 22253
21 Ga0466703_299289 3300042636 Bacteria 42101
22 Ga0466704_135019 3300042643 Bacteria 4700
23 Ga0466709_385770 3300042648 Bacteria 2685
24 Ga0466708_018977 3300042652 Bacteria 8795
25 Ga0466727_339691 3300042655 Bacteria 13089
26 Ga0466705_452509 3300042612 Bacteria 5221
27 Ga0466711_163818 3300042615 Bacteria 18116
28 Ga0466715_115602 3300042616 Bacteria 27738
29 Ga0466715_296206 3300042616 Bacteria 2534
30 Ga0466726_481358 3300042619 Bacteria 4781
31 Ga0466728_175212 3300042620 Unclassified 5762
32 Ga0466728_257865 3300042620 Bacteria 3294
33 2227542707 2225789004 Bacteria 2966
34 IMNBL1DRAFT_c0000030 3300000062 Bacteria 129938
35 JGI24695J34938_10014972 3300002450 Unclassified 3995
36 JGI24702J35022_10048229 3300002462 Bacteria 2267
37 Ga0466706_071583 3300042599 Bacteria 7457
38 Ga0466707_363294 3300042601 Bacteria 1821
39 Ga0466716_468140 3300042605 Bacteria 8089
40 Ga0466722_122253 3300042609 Bacteria 3426
41 Ga0466722_151371 3300042609 Bacteria 28601
42 Ga0466722_238594 3300042609 Bacteria 7349
43 Ga0415639_027688 3300038395 Bacteria 1930
44 Ga0466690_102424 3300042590 Bacteria 7908
45 Ga0466691_117279 3300042593 Bacteria 2887
46 Ga0466696_041524 3300042596 Bacteria 17700
47 Ga0123355_10067971 3300009826 Bacteria 5734
48 Ga0123353_10241457 3300010167 Unclassified 2807
49 Ga0123354_10000119 3300010882 Bacteria 59003
50 Ga0466703_244728 3300042636 Bacteria 5041
51 Ga0466703_431987 3300042636 Bacteria 5983
52 Ga0466704_136405 3300042643 Bacteria 3602
53 Ga0466704_467539 3300042643 Bacteria 4583
54 Ga0466708_373239 3300042652 Bacteria 5517
55 Ga0466727_290526 3300042655 Bacteria 40242
56 Ga0466727_327760 3300042655 Bacteria 2283
57 Ga0466733_038103 3300042659 Bacteria 1955
58 Ga0466711_156836 3300042615 Bacteria 14150
59 Ga0466715_012726 3300042616 Bacteria 5740
60 Ga0466715_055672 3300042616 Bacteria 27777
61 Ga0466723_072935 3300042618 Bacteria 24148
62 Ga0466723_313594 3300042618 Bacteria 97104
63 Ga0466726_312416 3300042619 Bacteria 4089
64 Ga0466726_374187 3300042619 Bacteria 3860
65 2227555177 2225789004 Bacteria 14831
66 IMNBL1DRAFT_c0000588 3300000062 Bacteria 29340
67 Ga0072941_1009613 3300005201 Bacteria 8549
68 Ga0104045_1001243 3300007085 Bacteria 7935
69 Ga0123357_10003414 3300009784 Bacteria 18181
70 Ga0466701_017566 3300042598 Bacteria 5297
71 Ga0466707_323398 3300042601 Bacteria 4330
72 Ga0466713_040569 3300042602 Unclassified 5461
73 Ga0466713_055585 3300042602 Bacteria 55506
74 Ga0466713_098617 3300042602 Bacteria 4174
75 Ga0466719_403306 3300042606 Bacteria 16121
76 Ga0466722_116342 3300042609 Bacteria 6574
77 Ga0466722_157573 3300042609 Bacteria 3967
78 Ga0466690_190702 3300042590 Bacteria 10126
79 Ga0466690_210864 3300042590 Bacteria 7238
80 Ga0466691_113018 3300042593 Bacteria 4301
81 Ga0466696_055404 3300042596 Bacteria 5928
82 Ga0123357_10272728 3300009784 Bacteria 1764
83 Ga0123355_10029208 3300009826 Bacteria 8922
84 Ga0123353_10004449 3300010167 Bacteria 18052
85 Ga0466735_191400 3300042624 Bacteria 6771
86 Ga0466704_229062 3300042643 Bacteria 13146
87 Ga0466708_245984 3300042652 Bacteria 2589
88 Ga0466708_385384 3300042652 Bacteria 2798
89 Ga0466727_295393 3300042655 Bacteria 3635
90 Ga0466705_253690 3300042612 Unclassified 2479
91 Ga0530661_000062 3300056564 Bacteria 106385
92 Ga0466715_303631 3300042616 Bacteria 5374
93 Ga0466723_047130 3300042618 Bacteria 6633
94 Ga0466726_214344 3300042619 Bacteria 19843
95 Ga0466726_264503 3300042619 Bacteria 14920
96 Ga0466726_311330 3300042619 Bacteria 1561
97 Ga0466728_277612 3300042620 Bacteria 1977
98 Ga0068302_10252884 3300005071 Bacteria 2359
99 Ga0466717_238626 3300042604 Archaea 1903
100 Ga0466716_211155 3300042605 Bacteria 1597
101 Ga0466716_315273 3300042605 Bacteria 1612
102 Ga0466719_297736 3300042606 Bacteria 18406
103 Ga0466694_262704 3300042594 Bacteria 6271
104 Ga0466704_045322 3300042643 Bacteria 1868
105 Ga0466704_206674 3300042643 Bacteria 1416
106 Ga0466704_279746 3300042643 Bacteria 16266
107 Ga0466709_076485 3300042648 Bacteria 4394
108 Ga0466708_013781 3300042652 Bacteria 4374
109 Ga0466708_140365 3300042652 Bacteria 10468
110 Ga0466708_369074 3300042652 Bacteria 16327
111 Ga0466727_087766 3300042655 Bacteria 28362
112 Ga0466705_205684 3300042612 Bacteria 5384
113 Ga0466715_106646 3300042616 Bacteria 8553
114 Ga0466715_182296 3300042616 Bacteria 50245
115 Ga0466715_235334 3300042616 Bacteria 4880
116 Ga0466715_607821 3300042616 Bacteria 13972
117 Ga0466726_169224 3300042619 Bacteria 2424
118 Ga0466726_197981 3300042619 Bacteria 5943
119 Ga0466726_327900 3300042619 Bacteria 3435
120 Ga0466726_329579 3300042619 Bacteria 2737
121 IMNBL1DRAFT_c0000371 3300000062 Bacteria 38321
122 Ga0466707_243724 3300042601 Bacteria 73222
123 Ga0466707_300195 3300042601 Bacteria 1690
124 Ga0466716_001694 3300042605 Unclassified 5832
125 Ga0466716_127151 3300042605 Bacteria 3719
126 Ga0160455_100055 3300012837 Bacteria 213023
127 Ga0415639_072151 3300038395 Bacteria 5840
128 Ga0466690_020337 3300042590 Bacteria 7749
129 Ga0466690_152160 3300042590 Bacteria 8282
130 Ga0466692_053255 3300042591 Bacteria 2138
131 Ga0466691_006376 3300042593 Bacteria 3361
132 Ga0123353_10062355 3300010167 Bacteria 5980
133 Ga0123353_10112827 3300010167 Bacteria 4376
134 Ga0123353_10179978 3300010167 Bacteria 3348
135 Ga0466704_124103 3300042643 Bacteria 3858
136 Ga0466709_331664 3300042648 Bacteria 9663
137 Ga0466708_005010 3300042652 Bacteria 2513
138 Ga0466711_012431 3300042615 Bacteria 1878
139 Ga0466711_106310 3300042615 Bacteria 10403
140 Ga0466715_008990 3300042616 Bacteria 8891
141 Ga0466715_033725 3300042616 Bacteria 56837
142 Ga0466715_460873 3300042616 Bacteria 7137
143 Ga0466723_079174 3300042618 Bacteria 17106
144 Ga0466726_205086 3300042619 Bacteria 8253
145 Ga0466726_206030 3300042619 Bacteria 3020
146 Ga0466729_036988 3300042621 Bacteria 3303
147 2227505185 2225789004 Bacteria 18832
148 IMNBL1DRAFT_c0038074 3300000062 Bacteria 1659
149 Ga0072940_1118376 3300005200 Bacteria 4510
150 Ga0466707_133690 3300042601 Bacteria 13939
151 Ga0466707_382413 3300042601 Bacteria 5711
152 Ga0466713_110240 3300042602 Bacteria 6040
153 Ga0466714_064606 3300042603 Bacteria 2676
154 Ga0466716_409402 3300042605 Unclassified 2458
155 Ga0466719_007753 3300042606 Bacteria 3335
156 Ga0466719_224922 3300042606 Bacteria 2601
157 Ga0466722_071161 3300042609 Bacteria 1534
158 Ga0466690_387637 3300042590 Bacteria 2763
159 Ga0466691_001454 3300042593 Bacteria 5050
160 Ga0466696_066795 3300042596 Bacteria 20973
161 Ga0466696_331190 3300042596 Bacteria 65152
162 Ga0123353_10045665 3300010167 Bacteria 6955
163 Ga0123353_10046728 3300010167 Bacteria 6882
164 Ga0123353_10283225 3300010167 Archaea 2544
165 Ga0466704_246626 3300042643 Bacteria 10340
166 Ga0466709_236752 3300042648 Bacteria 6079
167 Ga0466709_351286 3300042648 Bacteria 4596
168 Ga0466727_285711 3300042655 Bacteria 2031
169 Ga0466705_172089 3300042612 Bacteria 3879
170 Ga0466733_076850 3300042659 Bacteria 3426
171 Ga0466733_184373 3300042659 Bacteria 1526
172 Ga0466711_228515 3300042615 Bacteria 30331
173 Ga0466711_356969 3300042615 Bacteria 31563
174 Ga0466715_048388 3300042616 Bacteria 23291
175 Ga0466718_170094 3300042617 Bacteria 15036
176 Ga0466723_007799 3300042618 Unclassified 2308
177 Ga0466726_147478 3300042619 Bacteria 4713
178 IMNBL1DRAFT_c0000114 3300000062 Bacteria 72384
179 IMNBL1DRAFT_c0003824 3300000062 Bacteria 9382
180 IMNBL1DRAFT_c0006982 3300000062 Bacteria 6037
181 AustNasuHG_c1031600 3300000089 Bacteria 1491
182 Ga0068305_10626835 3300005083 Bacteria 6715
183 Ga0466700_149378 3300042600 Bacteria 3599
184 Ga0466707_090277 3300042601 Bacteria 24735
185 Ga0466707_417392 3300042601 Bacteria 3559
186 Ga0466713_057398 3300042602 Bacteria 69724
187 Ga0466714_056492 3300042603 Bacteria 15039
188 Ga0466719_101545 3300042606 Unclassified 2295
189 Ga0466719_209066 3300042606 Bacteria 2155
190 Ga0466722_079105 3300042609 Bacteria 18771
191 Ga0466692_087007 3300042591 Bacteria 34346
192 Ga0466696_322106 3300042596 Bacteria 5029
193 Ga0123355_10000247 3300009826 Bacteria 69710
194 Ga0123355_10049488 3300009826 Unclassified 6832
195 Ga0123353_10000381 3300010167 Bacteria 54377
196 Ga0123353_10198973 3300010167 Bacteria 3154
197 Ga0466729_298879 3300042621 Bacteria 94207
198 Ga0466703_051684 3300042636 Bacteria 60098
199 Ga0466703_236048 3300042636 Bacteria 21428
200 Ga0466704_142996 3300042643 Bacteria 19710
201 Ga0466704_265696 3300042643 Unclassified 3872
202 Ga0466727_095555 3300042655 Bacteria 9812
203 Ga0466727_178154 3300042655 Bacteria 1798
204 Ga0466727_256191 3300042655 Bacteria 4915
205 Ga0466705_238936 3300042612 Bacteria 4249
206 Ga0466705_496590 3300042612 Bacteria 9666
207 Ga0466711_367947 3300042615 Bacteria 7393
208 Ga0466715_533311 3300042616 Bacteria 4514
209 Ga0466723_079565 3300042618 Bacteria 6791
210 Ga0466723_117104 3300042618 Bacteria 30391
211 Ga0466723_150611 3300042618 Bacteria 21907
212 Ga0466723_231392 3300042618 Bacteria 3899
213 Ga0466726_254699 3300042619 Bacteria 1588
214 2227482711 2225789004 Bacteria 4371
215 Ga0466706_097696 3300042599 Bacteria 1787
216 Ga0466706_242432 3300042599 Bacteria 3790
217 Ga0466713_008592 3300042602 Bacteria 2821
218 Ga0466657_091901 3300042582 Bacteria 18124
219 Ga0466693_349466 3300042592 Unclassified 3079
220 Ga0466696_454361 3300042596 Bacteria 7212
221 Ga0123355_10006048 3300009826 Bacteria 17839
222 Ga0123355_10321265 3300009826 Bacteria 2085
223 Ga0123353_10083503 3300010167 Bacteria 5140
224 Ga0466703_191770 3300042636 Bacteria 6738
225 Ga0466703_325326 3300042636 Bacteria 6409
226 Ga0466704_114412 3300042643 Bacteria 38998
227 Ga0466708_235665 3300042652 Bacteria 20578

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01595 CNNM Cyclin M transmembrane N-terminal domain 26 220 0.99
PF03471 CorC_HlyC Transporter associated domain 366 443 0.94
PF00571 CBS CBS domain 237 294 0.91

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.