Protein Family IF07616
Metagenome
Isolate
273
Members
95
Samples
227
Scaffolds
435.75
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_033725|Ga0466715_033725_33863_35359
- Length
- 490 aa
- Sequence
- MTTENPDVLAAPDGGSTGNIYFRLVILFILILVNAFFAMSEIAIISLNDNKIDKLAGEGHKKARQILRLTANSSGFLSTIQIGVTLAGFLTSASAAEFFSPILANAFVGWFPALAGYETTIGTLSLVLVTLIMSYFSLVLGELVPKRIAMQKAEKVSYAVVGVLLFINKITTPFVKILSLSTNGVIRLIGLDPNADEEQVTEEEILMMVDVGEEKGVIENAQREMINNIFEFDDIDAGDIMTHRVDITAVEADEPVSEVVKAAIEDGYSRIPVYDDDPDNIVGIVYIKDLLKYIGQDMPTDTTIRYIMREAYFVPETKRCGELFNEMIEKHMQMAIIIDEFGGTAGLVTIEDLVEAIVGNIQDEYQINDSTFTVDGVTDIEEVDDLVGAALPEGDYDTIGGFIISQLGYLPVDGDLDIVTYENLIFTVLSVEDRRIGKIKIEILPRNEEGSHEKTKKEDAKDKPSEKKRAGKQRFEENAKAMRAADAAAE
Sample Types
Isolate
16.9%
Metagenome
83.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
25.0%
Termitidae
25.0%
Kalotermitidae
16.3%
Blattidae
7.6%
Rhinotermitidae
4.3%
Termopsidae
4.3%
Scarabaeidae
3.3%
Apidae
2.2%
Passalidae
2.2%
Drosophilidae
1.1%
Armadillidiidae
1.1%
Elmidae
1.1%
Blaberidae
1.1%
Thomisidae
1.1%
Tenebrionidae
1.1%
Hodotermitidae
1.1%
Cambaridae
1.1%
Reduviidae
1.1%
Taxonomy
Archaea
2
Bacteria
258
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 2 | 2963635624 | Unclassified Bacilli bacterium PM5-9 | Isolate | Blattidae |
| 3 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 4 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 5 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 6 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 7 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 8 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 9 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 10 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 11 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 16 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 17 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 18 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 19 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 20 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 21 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 22 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 23 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 32 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 33 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 34 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 35 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 36 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 37 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 38 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 41 | 2820854745 | Unclassified Actinobacteria Lab288P3bin234 | Isolate | Unclassified |
| 42 | 2963634138 | Unclassified Bacilli bacterium PM5-3 | Isolate | Blattidae |
| 43 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 44 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 45 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 46 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 47 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 48 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 49 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 50 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 51 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 52 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 53 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 54 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 55 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 56 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 57 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 58 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 59 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 60 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 61 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 62 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 63 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 64 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 65 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 66 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 67 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 68 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 74 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 75 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 76 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 77 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 78 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 79 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 80 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 81 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 82 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 83 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 84 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 85 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 86 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 87 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 88 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 89 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 90 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 91 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 92 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 93 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 94 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 95 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_153241 | 3300042612 | Bacteria | 8109 |
| 2 | Ga0466705_177216 | 3300042612 | Bacteria | 7950 |
| 3 | Ga0466712_103448 | 3300042614 | Bacteria | 2764 |
| 4 | Ga0466711_132222 | 3300042615 | Bacteria | 15378 |
| 5 | Ga0466711_186806 | 3300042615 | Bacteria | 11166 |
| 6 | Ga0466715_017964 | 3300042616 | Bacteria | 22310 |
| 7 | Ga0466723_157815 | 3300042618 | Unclassified | 5666 |
| 8 | Ga0068305_10003993 | 3300005083 | Bacteria | 109457 |
| 9 | Ga0466707_064956 | 3300042601 | Bacteria | 8476 |
| 10 | Ga0466716_274193 | 3300042605 | Bacteria | 3321 |
| 11 | Ga0466690_070460 | 3300042590 | Bacteria | 2647 |
| 12 | Ga0466690_150714 | 3300042590 | Bacteria | 5109 |
| 13 | Ga0466692_091867 | 3300042591 | Bacteria | 17888 |
| 14 | Ga0466692_127384 | 3300042591 | Bacteria | 123881 |
| 15 | Ga0466696_018162 | 3300042596 | Bacteria | 10656 |
| 16 | Ga0466696_189040 | 3300042596 | Bacteria | 11391 |
| 17 | Ga0466696_194009 | 3300042596 | Bacteria | 2088 |
| 18 | Ga0123355_10000163 | 3300009826 | Bacteria | 81520 |
| 19 | Ga0123353_10000339 | 3300010167 | Bacteria | 57571 |
| 20 | Ga0466703_145457 | 3300042636 | Bacteria | 22253 |
| 21 | Ga0466703_299289 | 3300042636 | Bacteria | 42101 |
| 22 | Ga0466704_135019 | 3300042643 | Bacteria | 4700 |
| 23 | Ga0466709_385770 | 3300042648 | Bacteria | 2685 |
| 24 | Ga0466708_018977 | 3300042652 | Bacteria | 8795 |
| 25 | Ga0466727_339691 | 3300042655 | Bacteria | 13089 |
| 26 | Ga0466705_452509 | 3300042612 | Bacteria | 5221 |
| 27 | Ga0466711_163818 | 3300042615 | Bacteria | 18116 |
| 28 | Ga0466715_115602 | 3300042616 | Bacteria | 27738 |
| 29 | Ga0466715_296206 | 3300042616 | Bacteria | 2534 |
| 30 | Ga0466726_481358 | 3300042619 | Bacteria | 4781 |
| 31 | Ga0466728_175212 | 3300042620 | Unclassified | 5762 |
| 32 | Ga0466728_257865 | 3300042620 | Bacteria | 3294 |
| 33 | 2227542707 | 2225789004 | Bacteria | 2966 |
| 34 | IMNBL1DRAFT_c0000030 | 3300000062 | Bacteria | 129938 |
| 35 | JGI24695J34938_10014972 | 3300002450 | Unclassified | 3995 |
| 36 | JGI24702J35022_10048229 | 3300002462 | Bacteria | 2267 |
| 37 | Ga0466706_071583 | 3300042599 | Bacteria | 7457 |
| 38 | Ga0466707_363294 | 3300042601 | Bacteria | 1821 |
| 39 | Ga0466716_468140 | 3300042605 | Bacteria | 8089 |
| 40 | Ga0466722_122253 | 3300042609 | Bacteria | 3426 |
| 41 | Ga0466722_151371 | 3300042609 | Bacteria | 28601 |
| 42 | Ga0466722_238594 | 3300042609 | Bacteria | 7349 |
| 43 | Ga0415639_027688 | 3300038395 | Bacteria | 1930 |
| 44 | Ga0466690_102424 | 3300042590 | Bacteria | 7908 |
| 45 | Ga0466691_117279 | 3300042593 | Bacteria | 2887 |
| 46 | Ga0466696_041524 | 3300042596 | Bacteria | 17700 |
| 47 | Ga0123355_10067971 | 3300009826 | Bacteria | 5734 |
| 48 | Ga0123353_10241457 | 3300010167 | Unclassified | 2807 |
| 49 | Ga0123354_10000119 | 3300010882 | Bacteria | 59003 |
| 50 | Ga0466703_244728 | 3300042636 | Bacteria | 5041 |
| 51 | Ga0466703_431987 | 3300042636 | Bacteria | 5983 |
| 52 | Ga0466704_136405 | 3300042643 | Bacteria | 3602 |
| 53 | Ga0466704_467539 | 3300042643 | Bacteria | 4583 |
| 54 | Ga0466708_373239 | 3300042652 | Bacteria | 5517 |
| 55 | Ga0466727_290526 | 3300042655 | Bacteria | 40242 |
| 56 | Ga0466727_327760 | 3300042655 | Bacteria | 2283 |
| 57 | Ga0466733_038103 | 3300042659 | Bacteria | 1955 |
| 58 | Ga0466711_156836 | 3300042615 | Bacteria | 14150 |
| 59 | Ga0466715_012726 | 3300042616 | Bacteria | 5740 |
| 60 | Ga0466715_055672 | 3300042616 | Bacteria | 27777 |
| 61 | Ga0466723_072935 | 3300042618 | Bacteria | 24148 |
| 62 | Ga0466723_313594 | 3300042618 | Bacteria | 97104 |
| 63 | Ga0466726_312416 | 3300042619 | Bacteria | 4089 |
| 64 | Ga0466726_374187 | 3300042619 | Bacteria | 3860 |
| 65 | 2227555177 | 2225789004 | Bacteria | 14831 |
| 66 | IMNBL1DRAFT_c0000588 | 3300000062 | Bacteria | 29340 |
| 67 | Ga0072941_1009613 | 3300005201 | Bacteria | 8549 |
| 68 | Ga0104045_1001243 | 3300007085 | Bacteria | 7935 |
| 69 | Ga0123357_10003414 | 3300009784 | Bacteria | 18181 |
| 70 | Ga0466701_017566 | 3300042598 | Bacteria | 5297 |
| 71 | Ga0466707_323398 | 3300042601 | Bacteria | 4330 |
| 72 | Ga0466713_040569 | 3300042602 | Unclassified | 5461 |
| 73 | Ga0466713_055585 | 3300042602 | Bacteria | 55506 |
| 74 | Ga0466713_098617 | 3300042602 | Bacteria | 4174 |
| 75 | Ga0466719_403306 | 3300042606 | Bacteria | 16121 |
| 76 | Ga0466722_116342 | 3300042609 | Bacteria | 6574 |
| 77 | Ga0466722_157573 | 3300042609 | Bacteria | 3967 |
| 78 | Ga0466690_190702 | 3300042590 | Bacteria | 10126 |
| 79 | Ga0466690_210864 | 3300042590 | Bacteria | 7238 |
| 80 | Ga0466691_113018 | 3300042593 | Bacteria | 4301 |
| 81 | Ga0466696_055404 | 3300042596 | Bacteria | 5928 |
| 82 | Ga0123357_10272728 | 3300009784 | Bacteria | 1764 |
| 83 | Ga0123355_10029208 | 3300009826 | Bacteria | 8922 |
| 84 | Ga0123353_10004449 | 3300010167 | Bacteria | 18052 |
| 85 | Ga0466735_191400 | 3300042624 | Bacteria | 6771 |
| 86 | Ga0466704_229062 | 3300042643 | Bacteria | 13146 |
| 87 | Ga0466708_245984 | 3300042652 | Bacteria | 2589 |
| 88 | Ga0466708_385384 | 3300042652 | Bacteria | 2798 |
| 89 | Ga0466727_295393 | 3300042655 | Bacteria | 3635 |
| 90 | Ga0466705_253690 | 3300042612 | Unclassified | 2479 |
| 91 | Ga0530661_000062 | 3300056564 | Bacteria | 106385 |
| 92 | Ga0466715_303631 | 3300042616 | Bacteria | 5374 |
| 93 | Ga0466723_047130 | 3300042618 | Bacteria | 6633 |
| 94 | Ga0466726_214344 | 3300042619 | Bacteria | 19843 |
| 95 | Ga0466726_264503 | 3300042619 | Bacteria | 14920 |
| 96 | Ga0466726_311330 | 3300042619 | Bacteria | 1561 |
| 97 | Ga0466728_277612 | 3300042620 | Bacteria | 1977 |
| 98 | Ga0068302_10252884 | 3300005071 | Bacteria | 2359 |
| 99 | Ga0466717_238626 | 3300042604 | Archaea | 1903 |
| 100 | Ga0466716_211155 | 3300042605 | Bacteria | 1597 |
| 101 | Ga0466716_315273 | 3300042605 | Bacteria | 1612 |
| 102 | Ga0466719_297736 | 3300042606 | Bacteria | 18406 |
| 103 | Ga0466694_262704 | 3300042594 | Bacteria | 6271 |
| 104 | Ga0466704_045322 | 3300042643 | Bacteria | 1868 |
| 105 | Ga0466704_206674 | 3300042643 | Bacteria | 1416 |
| 106 | Ga0466704_279746 | 3300042643 | Bacteria | 16266 |
| 107 | Ga0466709_076485 | 3300042648 | Bacteria | 4394 |
| 108 | Ga0466708_013781 | 3300042652 | Bacteria | 4374 |
| 109 | Ga0466708_140365 | 3300042652 | Bacteria | 10468 |
| 110 | Ga0466708_369074 | 3300042652 | Bacteria | 16327 |
| 111 | Ga0466727_087766 | 3300042655 | Bacteria | 28362 |
| 112 | Ga0466705_205684 | 3300042612 | Bacteria | 5384 |
| 113 | Ga0466715_106646 | 3300042616 | Bacteria | 8553 |
| 114 | Ga0466715_182296 | 3300042616 | Bacteria | 50245 |
| 115 | Ga0466715_235334 | 3300042616 | Bacteria | 4880 |
| 116 | Ga0466715_607821 | 3300042616 | Bacteria | 13972 |
| 117 | Ga0466726_169224 | 3300042619 | Bacteria | 2424 |
| 118 | Ga0466726_197981 | 3300042619 | Bacteria | 5943 |
| 119 | Ga0466726_327900 | 3300042619 | Bacteria | 3435 |
| 120 | Ga0466726_329579 | 3300042619 | Bacteria | 2737 |
| 121 | IMNBL1DRAFT_c0000371 | 3300000062 | Bacteria | 38321 |
| 122 | Ga0466707_243724 | 3300042601 | Bacteria | 73222 |
| 123 | Ga0466707_300195 | 3300042601 | Bacteria | 1690 |
| 124 | Ga0466716_001694 | 3300042605 | Unclassified | 5832 |
| 125 | Ga0466716_127151 | 3300042605 | Bacteria | 3719 |
| 126 | Ga0160455_100055 | 3300012837 | Bacteria | 213023 |
| 127 | Ga0415639_072151 | 3300038395 | Bacteria | 5840 |
| 128 | Ga0466690_020337 | 3300042590 | Bacteria | 7749 |
| 129 | Ga0466690_152160 | 3300042590 | Bacteria | 8282 |
| 130 | Ga0466692_053255 | 3300042591 | Bacteria | 2138 |
| 131 | Ga0466691_006376 | 3300042593 | Bacteria | 3361 |
| 132 | Ga0123353_10062355 | 3300010167 | Bacteria | 5980 |
| 133 | Ga0123353_10112827 | 3300010167 | Bacteria | 4376 |
| 134 | Ga0123353_10179978 | 3300010167 | Bacteria | 3348 |
| 135 | Ga0466704_124103 | 3300042643 | Bacteria | 3858 |
| 136 | Ga0466709_331664 | 3300042648 | Bacteria | 9663 |
| 137 | Ga0466708_005010 | 3300042652 | Bacteria | 2513 |
| 138 | Ga0466711_012431 | 3300042615 | Bacteria | 1878 |
| 139 | Ga0466711_106310 | 3300042615 | Bacteria | 10403 |
| 140 | Ga0466715_008990 | 3300042616 | Bacteria | 8891 |
| 141 | Ga0466715_033725 | 3300042616 | Bacteria | 56837 |
| 142 | Ga0466715_460873 | 3300042616 | Bacteria | 7137 |
| 143 | Ga0466723_079174 | 3300042618 | Bacteria | 17106 |
| 144 | Ga0466726_205086 | 3300042619 | Bacteria | 8253 |
| 145 | Ga0466726_206030 | 3300042619 | Bacteria | 3020 |
| 146 | Ga0466729_036988 | 3300042621 | Bacteria | 3303 |
| 147 | 2227505185 | 2225789004 | Bacteria | 18832 |
| 148 | IMNBL1DRAFT_c0038074 | 3300000062 | Bacteria | 1659 |
| 149 | Ga0072940_1118376 | 3300005200 | Bacteria | 4510 |
| 150 | Ga0466707_133690 | 3300042601 | Bacteria | 13939 |
| 151 | Ga0466707_382413 | 3300042601 | Bacteria | 5711 |
| 152 | Ga0466713_110240 | 3300042602 | Bacteria | 6040 |
| 153 | Ga0466714_064606 | 3300042603 | Bacteria | 2676 |
| 154 | Ga0466716_409402 | 3300042605 | Unclassified | 2458 |
| 155 | Ga0466719_007753 | 3300042606 | Bacteria | 3335 |
| 156 | Ga0466719_224922 | 3300042606 | Bacteria | 2601 |
| 157 | Ga0466722_071161 | 3300042609 | Bacteria | 1534 |
| 158 | Ga0466690_387637 | 3300042590 | Bacteria | 2763 |
| 159 | Ga0466691_001454 | 3300042593 | Bacteria | 5050 |
| 160 | Ga0466696_066795 | 3300042596 | Bacteria | 20973 |
| 161 | Ga0466696_331190 | 3300042596 | Bacteria | 65152 |
| 162 | Ga0123353_10045665 | 3300010167 | Bacteria | 6955 |
| 163 | Ga0123353_10046728 | 3300010167 | Bacteria | 6882 |
| 164 | Ga0123353_10283225 | 3300010167 | Archaea | 2544 |
| 165 | Ga0466704_246626 | 3300042643 | Bacteria | 10340 |
| 166 | Ga0466709_236752 | 3300042648 | Bacteria | 6079 |
| 167 | Ga0466709_351286 | 3300042648 | Bacteria | 4596 |
| 168 | Ga0466727_285711 | 3300042655 | Bacteria | 2031 |
| 169 | Ga0466705_172089 | 3300042612 | Bacteria | 3879 |
| 170 | Ga0466733_076850 | 3300042659 | Bacteria | 3426 |
| 171 | Ga0466733_184373 | 3300042659 | Bacteria | 1526 |
| 172 | Ga0466711_228515 | 3300042615 | Bacteria | 30331 |
| 173 | Ga0466711_356969 | 3300042615 | Bacteria | 31563 |
| 174 | Ga0466715_048388 | 3300042616 | Bacteria | 23291 |
| 175 | Ga0466718_170094 | 3300042617 | Bacteria | 15036 |
| 176 | Ga0466723_007799 | 3300042618 | Unclassified | 2308 |
| 177 | Ga0466726_147478 | 3300042619 | Bacteria | 4713 |
| 178 | IMNBL1DRAFT_c0000114 | 3300000062 | Bacteria | 72384 |
| 179 | IMNBL1DRAFT_c0003824 | 3300000062 | Bacteria | 9382 |
| 180 | IMNBL1DRAFT_c0006982 | 3300000062 | Bacteria | 6037 |
| 181 | AustNasuHG_c1031600 | 3300000089 | Bacteria | 1491 |
| 182 | Ga0068305_10626835 | 3300005083 | Bacteria | 6715 |
| 183 | Ga0466700_149378 | 3300042600 | Bacteria | 3599 |
| 184 | Ga0466707_090277 | 3300042601 | Bacteria | 24735 |
| 185 | Ga0466707_417392 | 3300042601 | Bacteria | 3559 |
| 186 | Ga0466713_057398 | 3300042602 | Bacteria | 69724 |
| 187 | Ga0466714_056492 | 3300042603 | Bacteria | 15039 |
| 188 | Ga0466719_101545 | 3300042606 | Unclassified | 2295 |
| 189 | Ga0466719_209066 | 3300042606 | Bacteria | 2155 |
| 190 | Ga0466722_079105 | 3300042609 | Bacteria | 18771 |
| 191 | Ga0466692_087007 | 3300042591 | Bacteria | 34346 |
| 192 | Ga0466696_322106 | 3300042596 | Bacteria | 5029 |
| 193 | Ga0123355_10000247 | 3300009826 | Bacteria | 69710 |
| 194 | Ga0123355_10049488 | 3300009826 | Unclassified | 6832 |
| 195 | Ga0123353_10000381 | 3300010167 | Bacteria | 54377 |
| 196 | Ga0123353_10198973 | 3300010167 | Bacteria | 3154 |
| 197 | Ga0466729_298879 | 3300042621 | Bacteria | 94207 |
| 198 | Ga0466703_051684 | 3300042636 | Bacteria | 60098 |
| 199 | Ga0466703_236048 | 3300042636 | Bacteria | 21428 |
| 200 | Ga0466704_142996 | 3300042643 | Bacteria | 19710 |
| 201 | Ga0466704_265696 | 3300042643 | Unclassified | 3872 |
| 202 | Ga0466727_095555 | 3300042655 | Bacteria | 9812 |
| 203 | Ga0466727_178154 | 3300042655 | Bacteria | 1798 |
| 204 | Ga0466727_256191 | 3300042655 | Bacteria | 4915 |
| 205 | Ga0466705_238936 | 3300042612 | Bacteria | 4249 |
| 206 | Ga0466705_496590 | 3300042612 | Bacteria | 9666 |
| 207 | Ga0466711_367947 | 3300042615 | Bacteria | 7393 |
| 208 | Ga0466715_533311 | 3300042616 | Bacteria | 4514 |
| 209 | Ga0466723_079565 | 3300042618 | Bacteria | 6791 |
| 210 | Ga0466723_117104 | 3300042618 | Bacteria | 30391 |
| 211 | Ga0466723_150611 | 3300042618 | Bacteria | 21907 |
| 212 | Ga0466723_231392 | 3300042618 | Bacteria | 3899 |
| 213 | Ga0466726_254699 | 3300042619 | Bacteria | 1588 |
| 214 | 2227482711 | 2225789004 | Bacteria | 4371 |
| 215 | Ga0466706_097696 | 3300042599 | Bacteria | 1787 |
| 216 | Ga0466706_242432 | 3300042599 | Bacteria | 3790 |
| 217 | Ga0466713_008592 | 3300042602 | Bacteria | 2821 |
| 218 | Ga0466657_091901 | 3300042582 | Bacteria | 18124 |
| 219 | Ga0466693_349466 | 3300042592 | Unclassified | 3079 |
| 220 | Ga0466696_454361 | 3300042596 | Bacteria | 7212 |
| 221 | Ga0123355_10006048 | 3300009826 | Bacteria | 17839 |
| 222 | Ga0123355_10321265 | 3300009826 | Bacteria | 2085 |
| 223 | Ga0123353_10083503 | 3300010167 | Bacteria | 5140 |
| 224 | Ga0466703_191770 | 3300042636 | Bacteria | 6738 |
| 225 | Ga0466703_325326 | 3300042636 | Bacteria | 6409 |
| 226 | Ga0466704_114412 | 3300042643 | Bacteria | 38998 |
| 227 | Ga0466708_235665 | 3300042652 | Bacteria | 20578 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.