Protein Family IF07582

Metagenome Isolate
110 Members
48 Samples
96 Scaffolds
331.53 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_482150|Ga0466711_482150_1280_2293
Length
337 aa
Sequence
MVQEEEIMLLKNSKALPNIPWEPRPQSSGAVSQSSPLWRYSGNPVIPRNLTAHSNSIFNSAVVPFKEGFAGVFRCDDTARRMNIYAGKSPDGFKWTIENKAIQFIKTKADLPDSEYKYDPRVVWVEDRYYIIWCNGYHGACIGMGWTQDFENFYLMENPFMPFNRNGVLFPRKIGSNYAILSRPSDSGHTPFGDIIYSESPDLTYWGKHRHVMAPSDGWQSTKVGAGPAPIETSEGWLLFYHGVLTSCNGFVYSFGAALLDRDEPWKVIARAEPYLIAPQTVYECVGDVPNVTFPCAALVDGDSGKLALYYGCADTVTGIVFGYIQDVLDFVKQYSY

📊 Sample Types

Isolate 12.7%
Metagenome 87.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 29.2%
Termitidae 20.8%
Unclassified 18.8%
Rhinotermitidae 10.4%
Blattidae 8.3%
Termopsidae 6.2%
Passalidae 4.2%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 103
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2923982719 Parabacteroides sp. 52 Isolate Blattidae
2 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
12 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
21 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
26 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
29 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
30 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
33 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
36 2922326829 Bacteroides sp. 224 Isolate Blattidae
37 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
38 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
42 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
43 3004667792 Bacteroides sp. 519 Isolate Blattidae
44 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_241772 3300042612 Bacteria 5183
2 Ga0466692_166797 3300042591 Bacteria 6208
3 Ga0466691_171761 3300042593 Bacteria 8861
4 Ga0466726_181771 3300042619 Bacteria 1602
5 Ga0123355_10008728 3300009826 Bacteria 15330
6 Ga0123355_10023204 3300009826 Bacteria 9962
7 Ga0466703_233395 3300042636 Bacteria 7110
8 Ga0466704_132186 3300042643 Bacteria 3415
9 Ga0466708_398896 3300042652 Bacteria 3182
10 Ga0466727_210643 3300042655 Bacteria 4294
11 Ga0466713_010120 3300042602 Bacteria 71739
12 Ga0466713_072590 3300042602 Unclassified 2876
13 Ga0466705_072422 3300042612 Bacteria 13043
14 Ga0466690_157919 3300042590 Bacteria 1929
15 Ga0466692_060728 3300042591 Bacteria 21885
16 Ga0466692_098163 3300042591 Unclassified 1220
17 Ga0466696_023880 3300042596 Bacteria 11842
18 Ga0466728_230803 3300042620 Bacteria 4951
19 Ga0466704_407406 3300042643 Bacteria 2786
20 Ga0466708_092814 3300042652 Unclassified 7955
21 Ga0466720_023862 3300042607 Bacteria 1846
22 Ga0466722_008032 3300042609 Bacteria 5224
23 Ga0466722_226598 3300042609 Bacteria 2275
24 Ga0466692_026839 3300042591 Bacteria 6091
25 Ga0466723_049006 3300042618 Unclassified 12438
26 Ga0466728_372569 3300042620 Bacteria 11808
27 Ga0466728_444112 3300042620 Bacteria 2212
28 Ga0466703_214705 3300042636 Bacteria 7615
29 Ga0466704_453363 3300042643 Bacteria 2157
30 Ga0466716_001162 3300042605 Bacteria 1579
31 Ga0466719_060566 3300042606 Bacteria 8463
32 Ga0466719_480983 3300042606 Bacteria 34203
33 Ga0466722_234260 3300042609 Bacteria 2502
34 JGI24695J34938_10000125 3300002450 Bacteria 68505
35 JGI24695J34938_10007110 3300002450 Bacteria 6615
36 Ga0466692_014659 3300042591 Bacteria 5099
37 Ga0466692_027058 3300042591 Bacteria 3296
38 Ga0466692_033992 3300042591 Bacteria 2391
39 Ga0466715_346956 3300042616 Bacteria 15859
40 Ga0466723_084877 3300042618 Bacteria 22711
41 Ga0466723_221716 3300042618 Bacteria 48106
42 Ga0466726_011009 3300042619 Bacteria 2006
43 Ga0466703_213227 3300042636 Bacteria 4162
44 Ga0466704_482495 3300042643 Bacteria 2958
45 Ga0466709_032032 3300042648 Bacteria 15711
46 JGI24695J34938_10050639 3300002450 Bacteria 1821
47 Ga0466705_381211 3300042612 Bacteria 2599
48 Ga0466692_000729 3300042591 Bacteria 15337
49 Ga0466691_024535 3300042593 Bacteria 31111
50 Ga0466691_210989 3300042593 Bacteria 2767
51 Ga0466694_071543 3300042594 Bacteria 5662
52 Ga0466699_337940 3300042597 Bacteria 1473
53 Ga0466715_283058 3300042616 Bacteria 1611
54 Ga0466726_172411 3300042619 Bacteria 1722
55 Ga0466729_056034 3300042621 Bacteria 9154
56 Ga0466703_083899 3300042636 Bacteria 18344
57 Ga0466703_356322 3300042636 Bacteria 2891
58 Ga0466722_030846 3300042609 Bacteria 4213
59 Ga0466722_117139 3300042609 Bacteria 7300
60 AustNasuHG_c1000898 3300000089 Bacteria 10731
61 JGI24695J34938_10000964 3300002450 Bacteria 26239
62 JGI24695J34938_10005224 3300002450 Bacteria 8194
63 Ga0466690_119737 3300042590 Unclassified 11134
64 Ga0466690_243698 3300042590 Bacteria 9795
65 Ga0466692_000154 3300042591 Bacteria 1733
66 Ga0466692_016813 3300042591 Bacteria 12278
67 Ga0466696_043105 3300042596 Bacteria 9415
68 Ga0466723_016511 3300042618 Bacteria 28122
69 Ga0123356_10106659 3300010049 Bacteria 2698
70 Ga0466703_110393 3300042636 Bacteria 6188
71 Ga0466709_293076 3300042648 Bacteria 4175
72 Ga0466708_066871 3300042652 Bacteria 12462
73 Ga0466727_008125 3300042655 Bacteria 1969
74 Ga0466713_135171 3300042602 Bacteria 4085
75 Ga0466716_406568 3300042605 Bacteria 8737
76 Ga0466720_222492 3300042607 Bacteria 1277
77 IMNBL1DRAFT_c0002816 3300000062 Bacteria 11730
78 Ga0466733_031483 3300042659 Bacteria 7559
79 Ga0466692_137162 3300042591 Bacteria 17219
80 Ga0466711_482150 3300042615 Bacteria 16436
81 Ga0466723_257827 3300042618 Bacteria 4689
82 Ga0466726_232206 3300042619 Bacteria 4120
83 Ga0466716_379475 3300042605 Bacteria 2838
84 Ga0466721_333648 3300042608 Bacteria 25376
85 2227584064 2225789004 Bacteria 2484
86 JGI24698J34947_10014858 3300002449 Bacteria 4240
87 Ga0466705_179514 3300042612 Bacteria 6721
88 Ga0466690_392222 3300042590 Unclassified 3324
89 Ga0466705_517749 3300042612 Bacteria 4922
90 Ga0466711_046540 3300042615 Bacteria 2010
91 Ga0466711_065460 3300042615 Bacteria 2642
92 Ga0466735_216292 3300042624 Bacteria 4165
93 Ga0466727_009823 3300042655 Bacteria 1841
94 Ga0466727_293553 3300042655 Unclassified 1338
95 Ga0466706_104537 3300042599 Bacteria 3522
96 Ga0466722_160951 3300042609 Bacteria 4646

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_210643 Ga0466727_210643_2606_3583 300
2 3300042612 Ga0466705_381211 Ga0466705_381211_433_1350 305
3 3300042609 Ga0466722_030846 Ga0466722_030846_1809_2729 306
4 3300042659 Ga0466733_031483 Ga0466733_031483_6593_7516 307
5 3300042591 Ga0466692_014659 Ga0466692_014659_2312_3289 308
6 3300042591 Ga0466692_098163 Ga0466692_098163_243_1202 319
7 3300042590 Ga0466690_157919 Ga0466690_157919_44_1006 320
8 3300042590 Ga0466690_243698 Ga0466690_243698_1812_2774 320
9 3300042612 Ga0466705_072422 Ga0466705_072422_5757_6719 320
10 3300042618 Ga0466723_016511 Ga0466723_016511_1219_2181 320
11 3300042620 Ga0466728_372569 Ga0466728_372569_9252_10214 320
12 3300042621 Ga0466729_056034 Ga0466729_056034_7456_8424 322
13 2225789004 2227584064 2228138089 323
14 3300042616 Ga0466715_346956 Ga0466715_346956_14388_15362 324
15 3300042624 Ga0466735_216292 Ga0466735_216292_3114_4088 324
16 iso_pr_bacteria 2609459943 2610742769 324
17 3300042605 Ga0466716_379475 Ga0466716_379475_968_1948 326
18 iso_pr_bacteria 2830041218 2830042739 326
19 3300042590 Ga0466690_119737 Ga0466690_119737_162_1145 327
20 3300042593 Ga0466691_171761 Ga0466691_171761_2667_3668 327
21 3300042593 Ga0466691_210989 Ga0466691_210989_237_1220 327
22 3300042618 Ga0466723_049006 Ga0466723_049006_3634_4617 327
23 3300042618 Ga0466723_084877 Ga0466723_084877_11295_12278 327
24 3300042620 Ga0466728_230803 Ga0466728_230803_1022_2008 328
25 3300042605 Ga0466716_001162 Ga0466716_001162_242_1231 329
26 3300042591 Ga0466692_027058 Ga0466692_027058_1989_2981 330
27 3300042597 Ga0466699_337940 Ga0466699_337940_442_1434 330
28 3300042615 Ga0466711_065460 Ga0466711_065460_16_1008 330
29 3300042591 Ga0466692_000154 Ga0466692_000154_727_1722 331
30 3300042591 Ga0466692_000729 Ga0466692_000729_12787_13782 331
31 3300042591 Ga0466692_137162 Ga0466692_137162_3348_4343 331
32 3300042599 Ga0466706_104537 Ga0466706_104537_428_1423 331
33 3300042607 Ga0466720_023862 Ga0466720_023862_345_1340 331
34 3300042607 Ga0466720_222492 Ga0466720_222492_22_1017 331
35 3300042616 Ga0466715_283058 Ga0466715_283058_162_1157 331
36 3300042619 Ga0466726_181771 Ga0466726_181771_403_1398 331
37 iso_pr_bacteria 2922326829 2922329726 331
38 iso_pr_bacteria 2923982719 2923984739 331
39 iso_pr_bacteria 2940371297 2940372470 331
40 3300000089 AustNasuHG_c1000898 AustNasuHG_10008984 332
41 3300042591 Ga0466692_166797 Ga0466692_166797_3043_4041 332
42 3300042608 Ga0466721_333648 Ga0466721_333648_19491_20489 332
43 3300042636 Ga0466703_110393 Ga0466703_110393_33_1031 332
44 3300042636 Ga0466703_213227 Ga0466703_213227_1571_2569 332
45 3300042652 Ga0466708_398896 Ga0466708_398896_1546_2544 332
46 iso_pr_bacteria 2781125683 2781410816 332
47 iso_pr_bacteria 2781125685 2781416969 332
48 iso_pr_bacteria 3004667792 3004669955 332
49 3300002449 JGI24698J34947_10014858 JGI24698J34947_100148583 333
50 3300002450 JGI24695J34938_10050639 JGI24695J34938_100506392 333
51 3300009826 Ga0123355_10008728 Ga0123355_100087289 333
52 3300009826 Ga0123355_10023204 Ga0123355_100232046 333
53 3300042591 Ga0466692_026839 Ga0466692_026839_788_1789 333
54 3300042593 Ga0466691_024535 Ga0466691_024535_8938_9939 333
55 3300042602 Ga0466713_010120 Ga0466713_010120_1590_2591 333
56 3300042602 Ga0466713_072590 Ga0466713_072590_286_1287 333
57 3300042619 Ga0466726_232206 Ga0466726_232206_346_1347 333
58 3300042620 Ga0466728_444112 Ga0466728_444112_186_1187 333
59 3300042636 Ga0466703_083899 Ga0466703_083899_50_1051 333
60 3300042636 Ga0466703_233395 Ga0466703_233395_5746_6747 333
61 3300042652 Ga0466708_066871 Ga0466708_066871_1765_2766 333
62 iso_pr_bacteria 8100166142 8100168167 333
63 3300000062 IMNBL1DRAFT_c0002816 IMNBL1DRAFT_00028162 334
64 3300042591 Ga0466692_016813 Ga0466692_016813_9058_10062 334
65 3300042591 Ga0466692_033992 Ga0466692_033992_1187_2191 334
66 3300042591 Ga0466692_060728 Ga0466692_060728_4994_5998 334
67 3300042606 Ga0466719_480983 Ga0466719_480983_13773_14777 334
68 3300042612 Ga0466705_179514 Ga0466705_179514_285_1289 334
69 3300042612 Ga0466705_241772 Ga0466705_241772_432_1436 334
70 3300042612 Ga0466705_517749 Ga0466705_517749_770_1774 334
71 3300042636 Ga0466703_214705 Ga0466703_214705_1051_2055 334
72 3300042636 Ga0466703_356322 Ga0466703_356322_1439_2443 334
73 3300042643 Ga0466704_407406 Ga0466704_407406_516_1520 334
74 3300042643 Ga0466704_482495 Ga0466704_482495_1407_2411 334
75 3300042652 Ga0466708_092814 Ga0466708_092814_6575_7579 334
76 iso_pr_bacteria 2695420314 2695472915 334
77 3300010049 Ga0123356_10106659 Ga0123356_101066592 335
78 3300042590 Ga0466690_392222 Ga0466690_392222_210_1217 335
79 3300042609 Ga0466722_117139 Ga0466722_117139_4826_5833 335
80 3300042609 Ga0466722_226598 Ga0466722_226598_161_1168 335
81 3300042609 Ga0466722_234260 Ga0466722_234260_235_1242 335
82 3300042615 Ga0466711_046540 Ga0466711_046540_185_1192 335
83 3300042618 Ga0466723_221716 Ga0466723_221716_32701_33708 335
84 3300042643 Ga0466704_132186 Ga0466704_132186_320_1327 335
85 3300042648 Ga0466709_032032 Ga0466709_032032_7307_8314 335
86 3300042648 Ga0466709_293076 Ga0466709_293076_2378_3385 335
87 3300042655 Ga0466727_293553 Ga0466727_293553_112_1119 335
88 3300042596 Ga0466696_043105 Ga0466696_043105_383_1393 336
89 3300042605 Ga0466716_406568 Ga0466716_406568_4898_5908 336
90 3300042618 Ga0466723_257827 Ga0466723_257827_1924_2934 336
91 3300042643 Ga0466704_453363 Ga0466704_453363_92_1102 336
92 iso_pr_bacteria 2781125640 2781288116 336
93 3300002450 JGI24695J34938_10007110 JGI24695J34938_100071105 337
94 3300042594 Ga0466694_071543 Ga0466694_071543_233_1246 337
95 3300042596 Ga0466696_023880 Ga0466696_023880_7521_8534 337
96 3300042615 Ga0466711_482150 Ga0466711_482150_1280_2293 337
97 3300042655 Ga0466727_009823 Ga0466727_009823_639_1652 337
98 iso_pr_bacteria 2781125644 2781295463 337
99 iso_pr_bacteria 2781125656 2781320077 337
100 iso_pr_bacteria 2781125682 2781408623 337
101 3300002450 JGI24695J34938_10000125 JGI24695J34938_1000012541 338
102 3300042609 Ga0466722_008032 Ga0466722_008032_1389_2405 338
103 3300002450 JGI24695J34938_10005224 JGI24695J34938_100052242 339
104 3300042602 Ga0466713_135171 Ga0466713_135171_572_1591 339
105 3300042609 Ga0466722_160951 Ga0466722_160951_937_1962 341
106 3300042606 Ga0466719_060566 Ga0466719_060566_3512_4540 342
107 3300002450 JGI24695J34938_10000964 JGI24695J34938_1000096417 343
108 3300042619 Ga0466726_172411 Ga0466726_172411_299_1360 353
109 3300042655 Ga0466727_008125 Ga0466727_008125_889_1950 353
110 3300042619 Ga0466726_011009 Ga0466726_011009_770_1846 358

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04041 Glyco_hydro_130 beta-1,4-mannooligosaccharide phosphorylase 42 333 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.