Protein Family IF07555
Metagenome
Isolate
240
Members
85
Samples
213
Scaffolds
263.91
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_366859|Ga0466711_366859_194_1165
- Length
- 323 aa
- Sequence
- MKEMKRGSNASAFYFKTALLDGCSPEIIILMYRKTVYNCFFFYFCSVETDSKNRKSMKLTIIGAGNMGGAIARGLANSAAVKASDIICSDCAKEALDKIRMTNPAIRTTSDNGEAVKNADIVLLAVKPWLLETVLAEIKSGLDYKRQIIISIVAGVTFAQLKEWLGSDAETAPVLFRLIPNTAIDVQNSMTFISSQNATPEQTGLIVSIFDELGTTLLVEERLMAAGTALASCGIAYAFRYIRAAMEGGVELGFYPEQAKNIVLQTLKGAVALLQANGTHPEAEIDKVSTPGGITIRGLNEMEHAGFTSAVIRGLKASKLNDV
Sample Types
Isolate
11.2%
Metagenome
88.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.6%
Blattidae
20.5%
Kalotermitidae
17.9%
Unclassified
9.0%
Culicidae
5.1%
Rhinotermitidae
5.1%
Termopsidae
5.1%
Passalidae
3.8%
Drosophilidae
1.3%
Hydrophilidae
1.3%
Armadillidiidae
1.3%
Hodotermitidae
1.3%
Bombycidae
1.3%
Tenebrionidae
1.3%
Taxonomy
Archaea
0
Bacteria
237
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 2 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 3 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 4 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 5 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 6 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 7 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 12 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 13 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 14 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 25 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 26 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 27 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 28 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 31 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 32 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 33 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 34 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 35 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 36 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 37 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 38 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 39 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 41 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 42 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 47 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 48 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 49 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 52 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 53 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 54 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 55 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 56 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 57 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 58 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 59 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 60 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 61 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 62 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 63 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 64 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 65 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 66 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 67 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 68 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 69 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 70 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 71 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 72 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 73 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 74 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 75 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 76 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 77 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 78 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 79 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 80 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 81 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 82 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 83 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 84 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 85 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_087347 | 3300042659 | Bacteria | 23276 |
| 2 | Ga0466733_113177 | 3300042659 | Bacteria | 40710 |
| 3 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 4 | 2227008145 | 2225789003 | Bacteria | 23710 |
| 5 | IMNBL1DRAFT_c0000725 | 3300000062 | Bacteria | 26173 |
| 6 | IMNBL1DRAFT_c0001423 | 3300000062 | Bacteria | 17909 |
| 7 | JGI24702J35022_10005021 | 3300002462 | Bacteria | 7802 |
| 8 | Ga0104045_1006711 | 3300007085 | Bacteria | 7567 |
| 9 | Ga0123357_10010550 | 3300009784 | Bacteria | 11764 |
| 10 | Ga0123353_10095152 | 3300010167 | Bacteria | 4799 |
| 11 | Ga0123354_10001008 | 3300010882 | Bacteria | 32139 |
| 12 | Ga0123354_10020243 | 3300010882 | Bacteria | 10459 |
| 13 | Ga0123354_10127934 | 3300010882 | Bacteria | 3230 |
| 14 | Ga0123354_10196547 | 3300010882 | Bacteria | 2235 |
| 15 | Ga0466710_215755 | 3300042613 | Bacteria | 1219 |
| 16 | Ga0466723_355198 | 3300042618 | Bacteria | 25887 |
| 17 | Ga0466728_446976 | 3300042620 | Bacteria | 5875 |
| 18 | Ga0160453_100018 | 3300012814 | Bacteria | 253724 |
| 19 | Ga0466694_009006 | 3300042594 | Bacteria | 3498 |
| 20 | Ga0466696_160871 | 3300042596 | Bacteria | 1466 |
| 21 | Ga0466713_060620 | 3300042602 | Bacteria | 398690 |
| 22 | Ga0466722_124502 | 3300042609 | Bacteria | 7370 |
| 23 | Ga0466722_253038 | 3300042609 | Bacteria | 7100 |
| 24 | Ga0466703_078312 | 3300042636 | Bacteria | 6232 |
| 25 | Ga0466704_227670 | 3300042643 | Bacteria | 14516 |
| 26 | Ga0466704_340525 | 3300042643 | Bacteria | 5681 |
| 27 | Ga0466708_138438 | 3300042652 | Bacteria | 9602 |
| 28 | Ga0466727_161849 | 3300042655 | Bacteria | 5386 |
| 29 | 2227219686 | 2225789004 | Bacteria | 32839 |
| 30 | JGI24705J35276_12163163 | 3300002504 | Bacteria | 1244 |
| 31 | JGI24699J35502_11134161 | 3300002509 | Bacteria | 40857 |
| 32 | Ga0123354_10110430 | 3300010882 | Bacteria | 3636 |
| 33 | Ga0466715_071107 | 3300042616 | Bacteria | 1684 |
| 34 | Ga0466715_606131 | 3300042616 | Bacteria | 2425 |
| 35 | Ga0466723_105125 | 3300042618 | Bacteria | 7881 |
| 36 | Ga0160467_100158 | 3300012829 | Bacteria | 94072 |
| 37 | Ga0466691_044824 | 3300042593 | Bacteria | 13767 |
| 38 | Ga0466706_063433 | 3300042599 | Bacteria | 14673 |
| 39 | Ga0466706_120308 | 3300042599 | Bacteria | 17593 |
| 40 | Ga0466700_029154 | 3300042600 | Bacteria | 1830 |
| 41 | Ga0466707_131352 | 3300042601 | Bacteria | 11891 |
| 42 | Ga0466713_150677 | 3300042602 | Bacteria | 11132 |
| 43 | Ga0466714_001728 | 3300042603 | Bacteria | 35313 |
| 44 | Ga0466716_173848 | 3300042605 | Bacteria | 43531 |
| 45 | Ga0466719_570336 | 3300042606 | Bacteria | 5834 |
| 46 | Ga0466735_217933 | 3300042624 | Bacteria | 2066 |
| 47 | Ga0466703_094378 | 3300042636 | Bacteria | 5881 |
| 48 | Ga0466703_402195 | 3300042636 | Bacteria | 11707 |
| 49 | Ga0466708_053809 | 3300042652 | Bacteria | 1101 |
| 50 | JGI24702J35022_10003394 | 3300002462 | Bacteria | 9609 |
| 51 | JGI24699J35502_11133056 | 3300002509 | Bacteria | 8477 |
| 52 | Ga0123357_10007548 | 3300009784 | Bacteria | 13455 |
| 53 | Ga0123355_10269650 | 3300009826 | Bacteria | 2367 |
| 54 | Ga0123356_10041702 | 3300010049 | Bacteria | 4277 |
| 55 | Ga0123353_10159923 | 3300010167 | Bacteria | 3587 |
| 56 | Ga0123353_10336736 | 3300010167 | Bacteria | 2281 |
| 57 | Ga0466726_486459 | 3300042619 | Bacteria | 4753 |
| 58 | Ga0160459_100019 | 3300012831 | Bacteria | 370950 |
| 59 | Ga0160446_100016 | 3300012835 | Bacteria | 260119 |
| 60 | Ga0466691_003484 | 3300042593 | Bacteria | 5216 |
| 61 | Ga0466691_205633 | 3300042593 | Bacteria | 5522 |
| 62 | Ga0466700_075052 | 3300042600 | Bacteria | 2331 |
| 63 | Ga0466707_015457 | 3300042601 | Bacteria | 6358 |
| 64 | Ga0466707_272109 | 3300042601 | Bacteria | 19065 |
| 65 | Ga0466713_043748 | 3300042602 | Bacteria | 36134 |
| 66 | Ga0466713_115233 | 3300042602 | Bacteria | 28611 |
| 67 | Ga0466713_129702 | 3300042602 | Unclassified | 4351 |
| 68 | Ga0466719_092583 | 3300042606 | Bacteria | 6411 |
| 69 | Ga0466719_253553 | 3300042606 | Bacteria | 9442 |
| 70 | Ga0466729_297224 | 3300042621 | Bacteria | 7158 |
| 71 | Ga0466735_057917 | 3300042624 | Bacteria | 2500 |
| 72 | Ga0466703_352062 | 3300042636 | Bacteria | 6366 |
| 73 | Ga0466708_299188 | 3300042652 | Bacteria | 34210 |
| 74 | Ga0466708_330262 | 3300042652 | Bacteria | 27220 |
| 75 | Ga0466705_224274 | 3300042612 | Bacteria | 5074 |
| 76 | Ga0466733_105763 | 3300042659 | Bacteria | 12305 |
| 77 | IMNBL1DRAFT_c0000468 | 3300000062 | Bacteria | 33779 |
| 78 | Ga0068305_10032150 | 3300005083 | Bacteria | 7165 |
| 79 | Ga0068305_10797486 | 3300005083 | Bacteria | 1242 |
| 80 | Ga0072941_1188180 | 3300005201 | Bacteria | 3234 |
| 81 | Ga0123354_10272904 | 3300010882 | Bacteria | 1660 |
| 82 | Ga0466728_002447 | 3300042620 | Bacteria | 1704 |
| 83 | Ga0466728_048266 | 3300042620 | Bacteria | 3527 |
| 84 | Ga0466690_068273 | 3300042590 | Bacteria | 14721 |
| 85 | Ga0466691_110838 | 3300042593 | Bacteria | 3525 |
| 86 | Ga0466706_138293 | 3300042599 | Bacteria | 60619 |
| 87 | Ga0466700_158672 | 3300042600 | Bacteria | 66427 |
| 88 | Ga0466707_090775 | 3300042601 | Bacteria | 1733 |
| 89 | Ga0466707_370878 | 3300042601 | Bacteria | 5717 |
| 90 | Ga0466713_041499 | 3300042602 | Bacteria | 101217 |
| 91 | Ga0466713_061265 | 3300042602 | Bacteria | 21524 |
| 92 | Ga0466716_036664 | 3300042605 | Bacteria | 4367 |
| 93 | Ga0466716_093077 | 3300042605 | Bacteria | 2664 |
| 94 | Ga0466735_090943 | 3300042624 | Bacteria | 2406 |
| 95 | Ga0466704_469671 | 3300042643 | Bacteria | 6741 |
| 96 | Ga0466727_232992 | 3300042655 | Bacteria | 2924 |
| 97 | Ga0466705_255468 | 3300042612 | Bacteria | 9565 |
| 98 | Ga0466733_011966 | 3300042659 | Bacteria | 8182 |
| 99 | JGI24702J35022_10019524 | 3300002462 | Bacteria | 3685 |
| 100 | JGI24699J35502_11134000 | 3300002509 | Bacteria | 23716 |
| 101 | Ga0068305_10021708 | 3300005083 | Bacteria | 17784 |
| 102 | Ga0068305_10070469 | 3300005083 | Bacteria | 6582 |
| 103 | Ga0123357_10006387 | 3300009784 | Bacteria | 14365 |
| 104 | Ga0466711_366859 | 3300042615 | Bacteria | 14957 |
| 105 | Ga0466715_123845 | 3300042616 | Bacteria | 7555 |
| 106 | Ga0466715_413404 | 3300042616 | Bacteria | 1982 |
| 107 | Ga0466723_127060 | 3300042618 | Bacteria | 8635 |
| 108 | Ga0466723_223232 | 3300042618 | Bacteria | 20243 |
| 109 | Ga0466723_266166 | 3300042618 | Bacteria | 15213 |
| 110 | Ga0466726_275675 | 3300042619 | Bacteria | 1359 |
| 111 | Ga0466726_318326 | 3300042619 | Bacteria | 2684 |
| 112 | Ga0466728_065940 | 3300042620 | Bacteria | 8129 |
| 113 | Ga0466728_419189 | 3300042620 | Bacteria | 4039 |
| 114 | Ga0466690_063672 | 3300042590 | Bacteria | 11801 |
| 115 | Ga0466691_036539 | 3300042593 | Bacteria | 23739 |
| 116 | Ga0466701_005522 | 3300042598 | Bacteria | 21003 |
| 117 | Ga0466701_076748 | 3300042598 | Bacteria | 2955 |
| 118 | Ga0466706_013284 | 3300042599 | Bacteria | 22625 |
| 119 | Ga0466706_135593 | 3300042599 | Bacteria | 13206 |
| 120 | Ga0466719_560517 | 3300042606 | Bacteria | 3975 |
| 121 | Ga0466722_074341 | 3300042609 | Bacteria | 7976 |
| 122 | Ga0466735_059475 | 3300042624 | Bacteria | 3292 |
| 123 | Ga0466735_178913 | 3300042624 | Bacteria | 1271 |
| 124 | Ga0466703_065073 | 3300042636 | Bacteria | 13959 |
| 125 | Ga0466708_039792 | 3300042652 | Bacteria | 2187 |
| 126 | JGI24699J35502_11134231 | 3300002509 | Bacteria | 105586 |
| 127 | Ga0068302_10012537 | 3300005071 | Unclassified | 5560 |
| 128 | Ga0123357_10000568 | 3300009784 | Bacteria | 36446 |
| 129 | Ga0123357_10268529 | 3300009784 | Bacteria | 1787 |
| 130 | Ga0123353_10471395 | 3300010167 | Bacteria | 1841 |
| 131 | Ga0123354_10107964 | 3300010882 | Bacteria | 3701 |
| 132 | Ga0123354_10156391 | 3300010882 | Bacteria | 2732 |
| 133 | Ga0160466_100006 | 3300012809 | Bacteria | 498369 |
| 134 | Ga0466711_104116 | 3300042615 | Bacteria | 2733 |
| 135 | Ga0466711_152133 | 3300042615 | Bacteria | 11698 |
| 136 | Ga0466711_415360 | 3300042615 | Bacteria | 6131 |
| 137 | Ga0466723_002914 | 3300042618 | Bacteria | 32279 |
| 138 | Ga0466726_076425 | 3300042619 | Bacteria | 2029 |
| 139 | Ga0466726_218744 | 3300042619 | Bacteria | 7727 |
| 140 | Ga0466691_020889 | 3300042593 | Bacteria | 16573 |
| 141 | Ga0466713_065595 | 3300042602 | Bacteria | 4349 |
| 142 | Ga0466713_137678 | 3300042602 | Bacteria | 8821 |
| 143 | Ga0466713_140874 | 3300042602 | Bacteria | 46073 |
| 144 | Ga0466698_251581 | 3300042610 | Unclassified | 1461 |
| 145 | Ga0466731_043486 | 3300042622 | Bacteria | 1001 |
| 146 | Ga0466703_089142 | 3300042636 | Bacteria | 4900 |
| 147 | Ga0466708_207180 | 3300042652 | Bacteria | 3661 |
| 148 | Ga0466727_095447 | 3300042655 | Bacteria | 23337 |
| 149 | Ga0466705_007790 | 3300042612 | Bacteria | 8233 |
| 150 | Ga0123356_10638982 | 3300010049 | Bacteria | 1231 |
| 151 | Ga0123356_10653471 | 3300010049 | Bacteria | 1219 |
| 152 | Ga0466715_007240 | 3300042616 | Bacteria | 11575 |
| 153 | Ga0466715_130115 | 3300042616 | Bacteria | 7059 |
| 154 | Ga0466715_211244 | 3300042616 | Bacteria | 22087 |
| 155 | Ga0466723_006875 | 3300042618 | Bacteria | 5918 |
| 156 | Ga0466723_047670 | 3300042618 | Bacteria | 16534 |
| 157 | Ga0466728_324049 | 3300042620 | Bacteria | 45950 |
| 158 | Ga0160472_105391 | 3300012839 | Bacteria | 2062 |
| 159 | Ga0466690_043642 | 3300042590 | Bacteria | 11167 |
| 160 | Ga0466692_008206 | 3300042591 | Bacteria | 1921 |
| 161 | Ga0466692_049252 | 3300042591 | Bacteria | 14960 |
| 162 | Ga0466706_005029 | 3300042599 | Bacteria | 45009 |
| 163 | Ga0466706_011822 | 3300042599 | Bacteria | 3780 |
| 164 | Ga0466700_410010 | 3300042600 | Bacteria | 5204 |
| 165 | Ga0466707_283024 | 3300042601 | Bacteria | 2096 |
| 166 | Ga0466707_305021 | 3300042601 | Bacteria | 4646 |
| 167 | Ga0466713_098989 | 3300042602 | Bacteria | 18122 |
| 168 | Ga0466714_132771 | 3300042603 | Bacteria | 10274 |
| 169 | Ga0466716_516457 | 3300042605 | Bacteria | 2142 |
| 170 | Ga0466719_313295 | 3300042606 | Bacteria | 15821 |
| 171 | Ga0466722_139992 | 3300042609 | Bacteria | 10006 |
| 172 | Ga0466734_016795 | 3300042623 | Bacteria | 2656 |
| 173 | Ga0466703_149168 | 3300042636 | Bacteria | 2403 |
| 174 | Ga0466703_369378 | 3300042636 | Bacteria | 6331 |
| 175 | Ga0466704_044947 | 3300042643 | Bacteria | 37107 |
| 176 | Ga0466709_219887 | 3300042648 | Bacteria | 10648 |
| 177 | Ga0466709_316559 | 3300042648 | Bacteria | 7987 |
| 178 | Ga0466708_106426 | 3300042652 | Bacteria | 8038 |
| 179 | Ga0466727_319003 | 3300042655 | Bacteria | 50861 |
| 180 | Ga0466697_239906 | 3300042611 | Bacteria | 2495 |
| 181 | Ga0466705_119612 | 3300042612 | Bacteria | 8501 |
| 182 | Ga0466705_289968 | 3300042612 | Bacteria | 1304 |
| 183 | Ga0466733_055750 | 3300042659 | Bacteria | 12185 |
| 184 | Ga0466733_113500 | 3300042659 | Bacteria | 62412 |
| 185 | Ga0466733_160784 | 3300042659 | Bacteria | 34990 |
| 186 | Ga0466733_162069 | 3300042659 | Bacteria | 4922 |
| 187 | IMNBL1DRAFT_c0019730 | 3300000062 | Bacteria | 2752 |
| 188 | Ga0123356_10164701 | 3300010049 | Bacteria | 2220 |
| 189 | Ga0123354_10026653 | 3300010882 | Bacteria | 9117 |
| 190 | Ga0466711_195085 | 3300042615 | Bacteria | 4101 |
| 191 | Ga0466711_255641 | 3300042615 | Bacteria | 5718 |
| 192 | Ga0466715_102786 | 3300042616 | Bacteria | 21811 |
| 193 | Ga0466715_494181 | 3300042616 | Bacteria | 14789 |
| 194 | Ga0466728_250780 | 3300042620 | Bacteria | 8539 |
| 195 | Ga0160460_100045 | 3300012845 | Bacteria | 232961 |
| 196 | Ga0466690_027402 | 3300042590 | Bacteria | 10228 |
| 197 | Ga0466693_035956 | 3300042592 | Bacteria | 1040 |
| 198 | Ga0466696_368481 | 3300042596 | Bacteria | 12350 |
| 199 | Ga0466707_309001 | 3300042601 | Bacteria | 34578 |
| 200 | Ga0466713_044092 | 3300042602 | Bacteria | 37791 |
| 201 | Ga0466713_128381 | 3300042602 | Bacteria | 2030 |
| 202 | Ga0466719_082083 | 3300042606 | Bacteria | 1823 |
| 203 | Ga0466719_313973 | 3300042606 | Bacteria | 4171 |
| 204 | Ga0466729_242318 | 3300042621 | Bacteria | 5121 |
| 205 | Ga0466731_205555 | 3300042622 | Bacteria | 1227 |
| 206 | Ga0466735_023729 | 3300042624 | Bacteria | 7648 |
| 207 | Ga0466735_221859 | 3300042624 | Bacteria | 3793 |
| 208 | Ga0466703_164473 | 3300042636 | Bacteria | 10682 |
| 209 | Ga0466703_231193 | 3300042636 | Bacteria | 14508 |
| 210 | Ga0466725_064564 | 3300042654 | Bacteria | 23138 |
| 211 | Ga0466727_061548 | 3300042655 | Bacteria | 36764 |
| 212 | Ga0466727_140607 | 3300042655 | Bacteria | 6995 |
| 213 | Ga0466727_328225 | 3300042655 | Bacteria | 15670 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.