Protein Family IF07554
Metagenome
Isolate
251
Members
59
Samples
241
Scaffolds
148.97
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_364369|Ga0466711_364369_73_615
- Length
- 180 aa
- Sequence
- MNIYTILCAKRNKLLEFFLLDRGRITPYNLEQMIELTTLKNYSLFGGLMEEQIGVILPFMEQESFEAGEDIMVEGSLNDKIRFILEGSVAVVKEHVILSEMKEGDTVGEMEVLDVMPAAATIKTLSHTKVMSLSNRNLREIYKKDIKIFSLLIMNLARDLSRRLRLMDKKTAENIQIDWN
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.1%
Kalotermitidae
23.2%
Unclassified
21.4%
Termopsidae
7.1%
Rhinotermitidae
5.4%
Hodotermitidae
1.8%
Taxonomy
Archaea
1
Bacteria
236
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 2 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 14 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 15 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 30 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 31 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 36 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 37 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 38 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 39 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 40 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 41 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 42 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 43 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 44 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 45 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 46 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 47 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 48 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 49 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 50 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 51 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 52 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 53 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 54 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 55 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 56 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 57 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 58 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 59 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_205021 | 3300042656 | Bacteria | 2009 |
| 2 | Ga0466733_016235 | 3300042659 | Bacteria | 27341 |
| 3 | Ga0456237_0018564 | 3300041968 | Bacteria | 972 |
| 4 | Ga0466692_180232 | 3300042591 | Bacteria | 17562 |
| 5 | Ga0466693_433055 | 3300042592 | Bacteria | 3832 |
| 6 | Ga0466691_053273 | 3300042593 | Bacteria | 11646 |
| 7 | Ga0466694_337552 | 3300042594 | Unclassified | 2088 |
| 8 | Ga0466699_421991 | 3300042597 | Bacteria | 1686 |
| 9 | Ga0466707_241243 | 3300042601 | Bacteria | 2558 |
| 10 | Ga0123356_10001388 | 3300010049 | Bacteria | 26863 |
| 11 | Ga0123356_10383333 | 3300010049 | Bacteria | 1539 |
| 12 | Ga0123356_12057539 | 3300010049 | Bacteria | 713 |
| 13 | Ga0123353_11442632 | 3300010167 | Bacteria | 881 |
| 14 | Ga0466705_419332 | 3300042612 | Bacteria | 8228 |
| 15 | Ga0466711_081702 | 3300042615 | Bacteria | 1018 |
| 16 | Ga0466711_252118 | 3300042615 | Unclassified | 2475 |
| 17 | Ga0466711_323955 | 3300042615 | Bacteria | 1975 |
| 18 | Ga0466715_536515 | 3300042616 | Bacteria | 1577 |
| 19 | Ga0466715_615447 | 3300042616 | Bacteria | 1031 |
| 20 | Ga0466718_027440 | 3300042617 | Bacteria | 3232 |
| 21 | JGI24695J34938_10000826 | 3300002450 | Bacteria | 28783 |
| 22 | Ga0072940_1057945 | 3300005200 | Bacteria | 9549 |
| 23 | Ga0072940_1079551 | 3300005200 | Unclassified | 921 |
| 24 | Ga0072941_1008624 | 3300005201 | Bacteria | 10394 |
| 25 | Ga0072941_1022290 | 3300005201 | Bacteria | 8084 |
| 26 | Ga0466703_285241 | 3300042636 | Bacteria | 1644 |
| 27 | Ga0466733_012842 | 3300042659 | Bacteria | 3307 |
| 28 | Ga0264413_103275 | 3300024493 | Bacteria | 1970 |
| 29 | Ga0415639_006462 | 3300038395 | Bacteria | 6525 |
| 30 | Ga0466692_100826 | 3300042591 | Bacteria | 6444 |
| 31 | Ga0466706_270206 | 3300042599 | Bacteria | 2248 |
| 32 | Ga0466707_074736 | 3300042601 | Bacteria | 1048 |
| 33 | Ga0466698_173421 | 3300042610 | Bacteria | 1924 |
| 34 | Ga0123356_11457566 | 3300010049 | Bacteria | 843 |
| 35 | Ga0123356_12695262 | 3300010049 | Bacteria | 622 |
| 36 | Ga0466712_177728 | 3300042614 | Bacteria | 11224 |
| 37 | Ga0466715_254695 | 3300042616 | Bacteria | 3526 |
| 38 | Ga0466718_107998 | 3300042617 | Bacteria | 6329 |
| 39 | Ga0466723_024722 | 3300042618 | Bacteria | 3993 |
| 40 | Ga0466726_007643 | 3300042619 | Bacteria | 6175 |
| 41 | Ga0466726_092332 | 3300042619 | Bacteria | 3199 |
| 42 | Ga0466726_215470 | 3300042619 | Bacteria | 4882 |
| 43 | Ga0466728_147080 | 3300042620 | Bacteria | 6052 |
| 44 | JGI24698J34947_10013344 | 3300002449 | Bacteria | 4486 |
| 45 | JGI24698J34947_10118745 | 3300002449 | Unclassified | 1152 |
| 46 | JGI24695J34938_10000185 | 3300002450 | Bacteria | 58369 |
| 47 | JGI24695J34938_10028269 | 3300002450 | Bacteria | 2637 |
| 48 | Ga0068302_10222158 | 3300005071 | Unclassified | 1387 |
| 49 | Ga0072940_1248577 | 3300005200 | Bacteria | 680 |
| 50 | Ga0072941_1057559 | 3300005201 | Unclassified | 2758 |
| 51 | Ga0072941_1281258 | 3300005201 | Bacteria | 1414 |
| 52 | Ga0466731_053805 | 3300042622 | Bacteria | 2238 |
| 53 | Ga0466702_343318 | 3300042635 | Bacteria | 2479 |
| 54 | Ga0466702_428572 | 3300042635 | Bacteria | 2615 |
| 55 | Ga0466709_127296 | 3300042648 | Bacteria | 13440 |
| 56 | Ga0466708_250075 | 3300042652 | Bacteria | 27777 |
| 57 | Ga0466708_287803 | 3300042652 | Bacteria | 1783 |
| 58 | Ga0466708_289197 | 3300042652 | Unclassified | 2088 |
| 59 | Ga0466733_078588 | 3300042659 | Bacteria | 5257 |
| 60 | Ga0264413_119878 | 3300024493 | Bacteria | 8309 |
| 61 | Ga0415639_152082 | 3300038395 | Unclassified | 2569 |
| 62 | Ga0466699_380228 | 3300042597 | Bacteria | 2894 |
| 63 | Ga0466706_102120 | 3300042599 | Bacteria | 1106 |
| 64 | Ga0466706_264438 | 3300042599 | Bacteria | 25507 |
| 65 | Ga0466716_237871 | 3300042605 | Bacteria | 1286 |
| 66 | Ga0466719_224728 | 3300042606 | Bacteria | 8009 |
| 67 | Ga0466719_549465 | 3300042606 | Bacteria | 2663 |
| 68 | Ga0466719_576025 | 3300042606 | Bacteria | 2156 |
| 69 | Ga0466720_052115 | 3300042607 | Bacteria | 1697 |
| 70 | Ga0466720_066220 | 3300042607 | Bacteria | 5773 |
| 71 | Ga0123356_10243521 | 3300010049 | Bacteria | 1871 |
| 72 | Ga0123356_10420944 | 3300010049 | Bacteria | 1478 |
| 73 | Ga0123353_10585093 | 3300010167 | Bacteria | 1600 |
| 74 | Ga0466711_037411 | 3300042615 | Bacteria | 6246 |
| 75 | Ga0466718_011614 | 3300042617 | Bacteria | 18606 |
| 76 | Ga0466723_044144 | 3300042618 | Bacteria | 4947 |
| 77 | Ga0466723_150375 | 3300042618 | Bacteria | 9865 |
| 78 | Ga0466726_047741 | 3300042619 | Bacteria | 1875 |
| 79 | Ga0466726_048593 | 3300042619 | Bacteria | 1725 |
| 80 | AustNasuHG_c1001556 | 3300000089 | Bacteria | 8266 |
| 81 | FAAS_10000151 | 3300001880 | Bacteria | 903 |
| 82 | JGI24698J34947_10083367 | 3300002449 | Bacteria | 1492 |
| 83 | JGI24695J34938_10002474 | 3300002450 | Bacteria | 14092 |
| 84 | Ga0072941_1008627 | 3300005201 | Bacteria | 14120 |
| 85 | Ga0072941_1044127 | 3300005201 | Bacteria | 1463 |
| 86 | Ga0466729_286939 | 3300042621 | Bacteria | 1199 |
| 87 | Ga0466731_350621 | 3300042622 | Bacteria | 35185 |
| 88 | Ga0466702_378435 | 3300042635 | Bacteria | 2008 |
| 89 | Ga0466704_051116 | 3300042643 | Bacteria | 38647 |
| 90 | Ga0466709_125265 | 3300042648 | Bacteria | 2704 |
| 91 | Ga0466708_039198 | 3300042652 | Bacteria | 2258 |
| 92 | Ga0466727_190853 | 3300042655 | Bacteria | 1463 |
| 93 | Ga0466691_004029 | 3300042593 | Bacteria | 6075 |
| 94 | Ga0466694_043748 | 3300042594 | Bacteria | 2376 |
| 95 | Ga0466699_006601 | 3300042597 | Bacteria | 1228 |
| 96 | Ga0466699_283678 | 3300042597 | Bacteria | 1031 |
| 97 | Ga0466706_105998 | 3300042599 | Bacteria | 1648 |
| 98 | Ga0466707_002561 | 3300042601 | Bacteria | 2654 |
| 99 | Ga0466707_159514 | 3300042601 | Archaea | 1427 |
| 100 | Ga0466719_118194 | 3300042606 | Bacteria | 4890 |
| 101 | Ga0123356_10000309 | 3300010049 | Bacteria | 55893 |
| 102 | Ga0123356_10009288 | 3300010049 | Bacteria | 9713 |
| 103 | Ga0123356_10093065 | 3300010049 | Bacteria | 2876 |
| 104 | Ga0123353_10491439 | 3300010167 | Bacteria | 1792 |
| 105 | Ga0466712_130840 | 3300042614 | Bacteria | 2259 |
| 106 | Ga0466712_281748 | 3300042614 | Bacteria | 3593 |
| 107 | Ga0466711_364369 | 3300042615 | Bacteria | 9237 |
| 108 | Ga0466726_410709 | 3300042619 | Bacteria | 9291 |
| 109 | Ga0466729_119580 | 3300042621 | Bacteria | 2586 |
| 110 | AustNasuHG_c1004837 | 3300000089 | Bacteria | 4821 |
| 111 | JGI24698J34947_10003106 | 3300002449 | Bacteria | 8996 |
| 112 | JGI24698J34947_10004897 | 3300002449 | Bacteria | 7337 |
| 113 | JGI24698J34947_10118122 | 3300002449 | Bacteria | 1157 |
| 114 | JGI24695J34938_10003140 | 3300002450 | Bacteria | 11765 |
| 115 | Ga0072940_1022677 | 3300005200 | Bacteria | 29727 |
| 116 | Ga0072941_1004505 | 3300005201 | Bacteria | 18383 |
| 117 | Ga0466735_160629 | 3300042624 | Bacteria | 1148 |
| 118 | Ga0466724_52548 | 3300042649 | Bacteria | 1095 |
| 119 | Ga0466727_310830 | 3300042655 | Bacteria | 9177 |
| 120 | Ga0415639_011336 | 3300038395 | Bacteria | 2554 |
| 121 | Ga0466692_000994 | 3300042591 | Bacteria | 4548 |
| 122 | Ga0466699_049207 | 3300042597 | Bacteria | 1955 |
| 123 | Ga0466707_345641 | 3300042601 | Bacteria | 1353 |
| 124 | Ga0466713_032392 | 3300042602 | Bacteria | 11817 |
| 125 | Ga0466719_242816 | 3300042606 | Bacteria | 17675 |
| 126 | Ga0466698_248911 | 3300042610 | Bacteria | 1152 |
| 127 | Ga0123356_10156657 | 3300010049 | Bacteria | 2269 |
| 128 | Ga0123356_10466478 | 3300010049 | Bacteria | 1413 |
| 129 | Ga0123356_11124818 | 3300010049 | Bacteria | 953 |
| 130 | Ga0123354_10170309 | 3300010882 | Bacteria | 2538 |
| 131 | Ga0466712_032763 | 3300042614 | Unclassified | 17655 |
| 132 | Ga0466715_607961 | 3300042616 | Bacteria | 29717 |
| 133 | Ga0466718_132721 | 3300042617 | Bacteria | 4875 |
| 134 | AustNasuHG_c1000129 | 3300000089 | Bacteria | 23435 |
| 135 | JGI24695J34938_10014233 | 3300002450 | Bacteria | 4135 |
| 136 | Ga0466735_176221 | 3300042624 | Bacteria | 1098 |
| 137 | Ga0466702_181569 | 3300042635 | Bacteria | 1784 |
| 138 | Ga0466702_300518 | 3300042635 | Bacteria | 2197 |
| 139 | Ga0466708_178435 | 3300042652 | Bacteria | 6201 |
| 140 | Ga0466708_295133 | 3300042652 | Bacteria | 2292 |
| 141 | Ga0466708_410171 | 3300042652 | Unclassified | 1604 |
| 142 | Ga0466727_067181 | 3300042655 | Bacteria | 3283 |
| 143 | Ga0466705_224221 | 3300042612 | Bacteria | 11059 |
| 144 | Ga0466733_052892 | 3300042659 | Bacteria | 14727 |
| 145 | Ga0264413_102444 | 3300024493 | Bacteria | 17994 |
| 146 | Ga0466690_061378 | 3300042590 | Bacteria | 6407 |
| 147 | Ga0466691_156306 | 3300042593 | Bacteria | 3787 |
| 148 | Ga0466699_161840 | 3300042597 | Bacteria | 1621 |
| 149 | Ga0466699_436982 | 3300042597 | Bacteria | 2362 |
| 150 | Ga0466700_150448 | 3300042600 | Bacteria | 12767 |
| 151 | Ga0466707_112435 | 3300042601 | Bacteria | 1290 |
| 152 | Ga0466716_017027 | 3300042605 | Unclassified | 2876 |
| 153 | Ga0466716_104172 | 3300042605 | Bacteria | 1075 |
| 154 | Ga0466716_315679 | 3300042605 | Bacteria | 28992 |
| 155 | Ga0466719_157161 | 3300042606 | Bacteria | 4047 |
| 156 | Ga0466720_072148 | 3300042607 | Bacteria | 21527 |
| 157 | Ga0466698_128763 | 3300042610 | Bacteria | 1214 |
| 158 | Ga0123355_11625884 | 3300009826 | Bacteria | 621 |
| 159 | Ga0123356_10129057 | 3300010049 | Bacteria | 2474 |
| 160 | Ga0466712_054999 | 3300042614 | Bacteria | 10183 |
| 161 | Ga0466712_161790 | 3300042614 | Bacteria | 1681 |
| 162 | Ga0466711_117211 | 3300042615 | Bacteria | 1139 |
| 163 | Ga0466715_427158 | 3300042616 | Bacteria | 13811 |
| 164 | Ga0466723_170116 | 3300042618 | Bacteria | 1346 |
| 165 | Ga0466723_353573 | 3300042618 | Bacteria | 1772 |
| 166 | Ga0466726_055965 | 3300042619 | Bacteria | 1387 |
| 167 | Ga0466728_391264 | 3300042620 | Bacteria | 4024 |
| 168 | AustNasuHG_c1006777 | 3300000089 | Bacteria | 4082 |
| 169 | AustNasuHG_c1017725 | 3300000089 | Bacteria | 2362 |
| 170 | AustNasuHG_c1050697 | 3300000089 | Unclassified | 890 |
| 171 | JGI24698J34947_10002914 | 3300002449 | Bacteria | 9280 |
| 172 | JGI24698J34947_10008238 | 3300002449 | Bacteria | 5717 |
| 173 | Ga0072941_1002241 | 3300005201 | Bacteria | 22976 |
| 174 | Ga0466703_024844 | 3300042636 | Bacteria | 4002 |
| 175 | Ga0466703_032951 | 3300042636 | Bacteria | 17490 |
| 176 | Ga0466704_135516 | 3300042643 | Bacteria | 50760 |
| 177 | Ga0466709_373763 | 3300042648 | Bacteria | 29333 |
| 178 | Ga0466708_340197 | 3300042652 | Bacteria | 51194 |
| 179 | Ga0466727_155030 | 3300042655 | Bacteria | 1550 |
| 180 | Ga0466690_205320 | 3300042590 | Bacteria | 1140 |
| 181 | Ga0466691_097897 | 3300042593 | Unclassified | 2153 |
| 182 | Ga0466694_147594 | 3300042594 | Bacteria | 2331 |
| 183 | Ga0466707_027972 | 3300042601 | Bacteria | 1009 |
| 184 | Ga0466707_319089 | 3300042601 | Bacteria | 7238 |
| 185 | Ga0466707_392175 | 3300042601 | Bacteria | 1120 |
| 186 | Ga0466720_041733 | 3300042607 | Bacteria | 6706 |
| 187 | Ga0466712_071505 | 3300042614 | Bacteria | 3881 |
| 188 | Ga0466712_320346 | 3300042614 | Bacteria | 17677 |
| 189 | Ga0466723_051474 | 3300042618 | Bacteria | 4921 |
| 190 | Ga0466723_277920 | 3300042618 | Bacteria | 1103 |
| 191 | AustNasuHG_c1001957 | 3300000089 | Bacteria | 7413 |
| 192 | Ga0072940_1061773 | 3300005200 | Bacteria | 870 |
| 193 | Ga0072940_1172139 | 3300005200 | Bacteria | 665 |
| 194 | Ga0072941_1011503 | 3300005201 | Bacteria | 13279 |
| 195 | Ga0072941_1402613 | 3300005201 | Bacteria | 1027 |
| 196 | Ga0466704_009068 | 3300042643 | Unclassified | 1159 |
| 197 | Ga0466704_153752 | 3300042643 | Bacteria | 27441 |
| 198 | Ga0466704_510610 | 3300042643 | Bacteria | 5084 |
| 199 | Ga0466709_064206 | 3300042648 | Bacteria | 1543 |
| 200 | Ga0466709_071791 | 3300042648 | Bacteria | 2200 |
| 201 | Ga0466709_324646 | 3300042648 | Bacteria | 5814 |
| 202 | Ga0466708_105556 | 3300042652 | Bacteria | 1127 |
| 203 | Ga0466708_443463 | 3300042652 | Bacteria | 18075 |
| 204 | Ga0466727_241346 | 3300042655 | Bacteria | 1561 |
| 205 | Ga0466705_177044 | 3300042612 | Bacteria | 1964 |
| 206 | Ga0466705_256950 | 3300042612 | Bacteria | 10527 |
| 207 | Ga0466705_309439 | 3300042612 | Bacteria | 1161 |
| 208 | Ga0466733_125314 | 3300042659 | Bacteria | 5006 |
| 209 | Ga0264413_125531 | 3300024493 | Bacteria | 1381 |
| 210 | Ga0415639_038139 | 3300038395 | Bacteria | 12761 |
| 211 | Ga0466692_091356 | 3300042591 | Bacteria | 1811 |
| 212 | Ga0466692_135667 | 3300042591 | Bacteria | 8553 |
| 213 | Ga0466691_024736 | 3300042593 | Bacteria | 1676 |
| 214 | Ga0466691_027698 | 3300042593 | Bacteria | 8246 |
| 215 | Ga0466699_011095 | 3300042597 | Bacteria | 1008 |
| 216 | Ga0466699_066053 | 3300042597 | Bacteria | 5875 |
| 217 | Ga0466699_212251 | 3300042597 | Bacteria | 4007 |
| 218 | Ga0466713_126762 | 3300042602 | Bacteria | 2039 |
| 219 | Ga0466717_177895 | 3300042604 | Bacteria | 1467 |
| 220 | Ga0466716_490753 | 3300042605 | Bacteria | 2242 |
| 221 | Ga0466720_004288 | 3300042607 | Bacteria | 2589 |
| 222 | Ga0466720_039521 | 3300042607 | Bacteria | 7745 |
| 223 | Ga0123356_10010682 | 3300010049 | Bacteria | 8988 |
| 224 | Ga0123356_10021461 | 3300010049 | Bacteria | 6094 |
| 225 | Ga0123356_10102808 | 3300010049 | Bacteria | 2743 |
| 226 | Ga0466705_400677 | 3300042612 | Bacteria | 1130 |
| 227 | Ga0466705_512622 | 3300042612 | Bacteria | 14154 |
| 228 | Ga0466712_015711 | 3300042614 | Bacteria | 6455 |
| 229 | Ga0466712_081319 | 3300042614 | Bacteria | 10580 |
| 230 | Ga0466711_242727 | 3300042615 | Bacteria | 15037 |
| 231 | Ga0466718_034768 | 3300042617 | Bacteria | 15573 |
| 232 | Ga0466718_052767 | 3300042617 | Bacteria | 1430 |
| 233 | Ga0466726_175555 | 3300042619 | Bacteria | 1009 |
| 234 | Ga0466726_453490 | 3300042619 | Bacteria | 1190 |
| 235 | JGI24695J34938_10000008 | 3300002450 | Bacteria | 136681 |
| 236 | JGI24695J34938_10000986 | 3300002450 | Bacteria | 25876 |
| 237 | Ga0466709_026523 | 3300042648 | Bacteria | 1492 |
| 238 | Ga0466708_382732 | 3300042652 | Bacteria | 2973 |
| 239 | Ga0466727_086746 | 3300042655 | Bacteria | 3755 |
| 240 | Ga0466727_178172 | 3300042655 | Bacteria | 11964 |
| 241 | Ga0466727_259564 | 3300042655 | Bacteria | 1807 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00027 | cNMP_binding | Cyclic nucleotide-binding domain | 63 | 145 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.