Protein Family IF07510
Metagenome
Isolate
118
Members
49
Samples
107
Scaffolds
191.72
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_166802|Ga0466711_166802_43697_44353
- Length
- 218 aa
- Sequence
- MLLLFVFSPPRGAGWLLRQAHPIKKRGRPEMLLMIDNYDSFTYNIAQYFGELGQEVRVYRNDAITLDEIAAQKPDYLLVGPGPCAPAQAGISLAAIKTFAGKIPLLGVCLGHQAIGEAFGGKVVHAQKLMHGKVSPVRHNNAGVFRGLPDPLACTRYHSLAIERASLPDCLEISAWTEDGEIMGVRHKTLAVAGVQFHPESILSERGHDLLENFLKNV
Sample Types
Isolate
9.3%
Metagenome
90.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
29.8%
Termitidae
27.7%
Unclassified
19.1%
Rhinotermitidae
8.5%
Termopsidae
6.4%
Passalidae
4.3%
Hodotermitidae
2.1%
Elmidae
2.1%
Taxonomy
Archaea
0
Bacteria
107
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 2 | 2820716747 | Unclassified Fibrobacteres Nc150P3bin18 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 15 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 21 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 2773857779 | Unclassified Fibrobacteres Co191P1bin69 | Isolate | Unclassified |
| 29 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 30 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 33 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 40 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 43 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 44 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 45 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_166802 | 3300042615 | Bacteria | 47712 |
| 2 | Ga0466702_364193 | 3300042635 | Bacteria | 2960 |
| 3 | Ga0466708_083140 | 3300042652 | Bacteria | 34789 |
| 4 | Ga0466727_312045 | 3300042655 | Bacteria | 91345 |
| 5 | Ga0466720_096842 | 3300042607 | Bacteria | 28414 |
| 6 | Ga0466722_167076 | 3300042609 | Bacteria | 38437 |
| 7 | JGI24695J34938_10023940 | 3300002450 | Bacteria | 2937 |
| 8 | Ga0072941_1011714 | 3300005201 | Bacteria | 43456 |
| 9 | Ga0466715_392793 | 3300042616 | Bacteria | 2129 |
| 10 | Ga0466729_112696 | 3300042621 | Bacteria | 17308 |
| 11 | Ga0466703_125340 | 3300042636 | Bacteria | 1906 |
| 12 | Ga0466703_265045 | 3300042636 | Bacteria | 20990 |
| 13 | Ga0466704_107050 | 3300042643 | Unclassified | 2733 |
| 14 | Ga0466709_073238 | 3300042648 | Bacteria | 8134 |
| 15 | Ga0466708_146564 | 3300042652 | Bacteria | 4070 |
| 16 | Ga0264413_102044 | 3300024493 | Bacteria | 6214 |
| 17 | Ga0456237_0005571 | 3300041968 | Bacteria | 1991 |
| 18 | Ga0466690_025051 | 3300042590 | Unclassified | 3010 |
| 19 | Ga0466692_198950 | 3300042591 | Bacteria | 3552 |
| 20 | Ga0466696_205055 | 3300042596 | Bacteria | 11075 |
| 21 | Ga0466719_093354 | 3300042606 | Bacteria | 3426 |
| 22 | Ga0466722_009756 | 3300042609 | Bacteria | 2596 |
| 23 | 2227637127 | 2225789004 | Bacteria | 2082 |
| 24 | Ga0072941_1060257 | 3300005201 | Bacteria | 25311 |
| 25 | Ga0466712_310404 | 3300042614 | Unclassified | 1037 |
| 26 | Ga0466718_046236 | 3300042617 | Bacteria | 16297 |
| 27 | Ga0466726_299216 | 3300042619 | Bacteria | 10373 |
| 28 | Ga0466726_427538 | 3300042619 | Unclassified | 1061 |
| 29 | Ga0466728_216155 | 3300042620 | Bacteria | 24645 |
| 30 | Ga0466704_469272 | 3300042643 | Bacteria | 7592 |
| 31 | Ga0466704_545540 | 3300042643 | Bacteria | 3938 |
| 32 | Ga0466708_397192 | 3300042652 | Bacteria | 1635 |
| 33 | Ga0466708_422936 | 3300042652 | Bacteria | 29594 |
| 34 | Ga0264413_105291 | 3300024493 | Unclassified | 6614 |
| 35 | Ga0466692_174517 | 3300042591 | Unclassified | 4620 |
| 36 | Ga0466716_237917 | 3300042605 | Bacteria | 3157 |
| 37 | Ga0466716_307309 | 3300042605 | Bacteria | 1623 |
| 38 | Ga0466719_493491 | 3300042606 | Bacteria | 2159 |
| 39 | Ga0466720_120928 | 3300042607 | Unclassified | 43419 |
| 40 | Ga0072941_1553635 | 3300005201 | Bacteria | 3605 |
| 41 | Ga0466705_171804 | 3300042612 | Bacteria | 2571 |
| 42 | Ga0466735_113036 | 3300042624 | Bacteria | 3819 |
| 43 | Ga0466709_098979 | 3300042648 | Bacteria | 14738 |
| 44 | Ga0466708_009052 | 3300042652 | Bacteria | 7127 |
| 45 | Ga0466725_409702 | 3300042654 | Bacteria | 4578 |
| 46 | Ga0466727_005887 | 3300042655 | Bacteria | 1108 |
| 47 | Ga0264413_106285 | 3300024493 | Unclassified | 1855 |
| 48 | Ga0466692_147464 | 3300042591 | Bacteria | 6857 |
| 49 | Ga0466692_188500 | 3300042591 | Bacteria | 54661 |
| 50 | Ga0466693_074060 | 3300042592 | Bacteria | 4324 |
| 51 | Ga0466706_004054 | 3300042599 | Bacteria | 14927 |
| 52 | Ga0466719_060075 | 3300042606 | Bacteria | 1144 |
| 53 | Ga0466719_571115 | 3300042606 | Bacteria | 8168 |
| 54 | IMNBL1DRAFT_c0002865 | 3300000062 | Bacteria | 11567 |
| 55 | JGI24695J34938_10015831 | 3300002450 | Unclassified | 3855 |
| 56 | Ga0072941_1006722 | 3300005201 | Bacteria | 35663 |
| 57 | Ga0466711_283651 | 3300042615 | Bacteria | 3038 |
| 58 | Ga0466718_117184 | 3300042617 | Bacteria | 7828 |
| 59 | Ga0466729_021709 | 3300042621 | Bacteria | 4367 |
| 60 | Ga0466708_022857 | 3300042652 | Bacteria | 16993 |
| 61 | Ga0466708_225707 | 3300042652 | Bacteria | 11320 |
| 62 | Ga0466690_086267 | 3300042590 | Bacteria | 1707 |
| 63 | Ga0466691_038159 | 3300042593 | Bacteria | 2863 |
| 64 | Ga0466719_344339 | 3300042606 | Bacteria | 1410 |
| 65 | Ga0123357_10000189 | 3300009784 | Bacteria | 57563 |
| 66 | Ga0123356_10042525 | 3300010049 | Bacteria | 4232 |
| 67 | Ga0466711_103537 | 3300042615 | Bacteria | 3495 |
| 68 | Ga0466728_099118 | 3300042620 | Bacteria | 11096 |
| 69 | Ga0466692_073311 | 3300042591 | Bacteria | 3785 |
| 70 | Ga0466692_147377 | 3300042591 | Bacteria | 11800 |
| 71 | Ga0466706_221160 | 3300042599 | Bacteria | 11237 |
| 72 | Ga0466707_219814 | 3300042601 | Bacteria | 15271 |
| 73 | Ga0466719_048630 | 3300042606 | Bacteria | 8114 |
| 74 | Ga0466719_115776 | 3300042606 | Bacteria | 3323 |
| 75 | Ga0466705_211452 | 3300042612 | Bacteria | 6801 |
| 76 | Ga0466711_047272 | 3300042615 | Bacteria | 2797 |
| 77 | Ga0466711_119471 | 3300042615 | Bacteria | 7501 |
| 78 | Ga0466723_046048 | 3300042618 | Bacteria | 3873 |
| 79 | Ga0466726_257945 | 3300042619 | Bacteria | 1130 |
| 80 | Ga0466728_094048 | 3300042620 | Bacteria | 1513 |
| 81 | Ga0466734_078578 | 3300042623 | Bacteria | 5648 |
| 82 | Ga0466709_313539 | 3300042648 | Bacteria | 5658 |
| 83 | Ga0466708_314644 | 3300042652 | Bacteria | 6653 |
| 84 | Ga0264413_105290 | 3300024493 | Unclassified | 4282 |
| 85 | Ga0456237_0001721 | 3300041968 | Bacteria | 3514 |
| 86 | Ga0466657_147318 | 3300042582 | Bacteria | 1922 |
| 87 | Ga0466690_311348 | 3300042590 | Bacteria | 2744 |
| 88 | Ga0466706_125192 | 3300042599 | Bacteria | 14180 |
| 89 | Ga0466716_003642 | 3300042605 | Bacteria | 2986 |
| 90 | Ga0466719_303047 | 3300042606 | Bacteria | 9213 |
| 91 | Ga0466722_132557 | 3300042609 | Bacteria | 47947 |
| 92 | Ga0466733_182496 | 3300042659 | Bacteria | 4696 |
| 93 | Ga0123353_10550366 | 3300010167 | Bacteria | 1665 |
| 94 | Ga0466712_195429 | 3300042614 | Bacteria | 2331 |
| 95 | Ga0466712_233970 | 3300042614 | Unclassified | 9975 |
| 96 | Ga0466715_333249 | 3300042616 | Bacteria | 2697 |
| 97 | Ga0466726_410416 | 3300042619 | Bacteria | 1066 |
| 98 | Ga0466728_005166 | 3300042620 | Bacteria | 2934 |
| 99 | Ga0466703_096889 | 3300042636 | Bacteria | 6010 |
| 100 | Ga0264413_100144 | 3300024493 | Bacteria | 4229 |
| 101 | Ga0264413_101973 | 3300024493 | Bacteria | 3029 |
| 102 | Ga0466690_310651 | 3300042590 | Bacteria | 16888 |
| 103 | Ga0466706_212234 | 3300042599 | Bacteria | 16404 |
| 104 | Ga0466707_116298 | 3300042601 | Bacteria | 1628 |
| 105 | Ga0466716_262965 | 3300042605 | Bacteria | 2279 |
| 106 | Ga0466719_298452 | 3300042606 | Bacteria | 2489 |
| 107 | Ga0072941_1180535 | 3300005201 | Bacteria | 4340 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF07722 | GO:0016787 | hydrolase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.