Protein Family IF07502
Metagenome
Isolate
169
Members
55
Samples
165
Scaffolds
432.09
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_148907|Ga0466711_148907_1673_3061
- Length
- 462 aa
- Sequence
- MRMPEIEYQPLEVIRHFQEKKLAGALEYLSRFSPFYRRMFAENRIDVAKIRTIADLQQIPFTEKSALQSHNDEFLCVARHKIIDYITTSGTLGDPATFAMTDADLDRLAYNEKISFECAGAEPGDIFQLMTTIDKRFMAGLAYFLGVRKLGAGIIRVGNGIPELQWDTIRRIKPNTIIVVPSFILKIIRYAEEHGIDHRASSVKKAICIGENLREQDFSLNLLGKSIREKWGIELYSTYASTEMATTFTECAFGCGGHHHPELIICELADENGRPVAEGETGELVVTTLGVEGMPLLRFRTGDLARFHREPCRCGRTSMRISPIVGRKDHMVKYKGTSLYPPAVFDVLDNTSYVENYVMVVSDNECGNDHVLVLAGLREPPGYDAVKDLKDRFRARIRVAPDVEIRPAEEIRKINFPDTSRKPVKFIDRRKAANHHSITNNQQSTINWKINSKTSAPTGNRK
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.5%
Kalotermitidae
25.5%
Unclassified
12.7%
Rhinotermitidae
5.5%
Termopsidae
5.5%
Passalidae
3.6%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 28 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 33 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 34 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 35 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 36 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 37 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 38 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 41 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 50 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_055799 | 3300042659 | Bacteria | 106016 |
| 2 | Ga0123354_10213450 | 3300010882 | Bacteria | 2076 |
| 3 | Ga0466690_015023 | 3300042590 | Bacteria | 27335 |
| 4 | Ga0466692_046708 | 3300042591 | Bacteria | 150257 |
| 5 | Ga0466696_165406 | 3300042596 | Bacteria | 15212 |
| 6 | Ga0466735_169084 | 3300042624 | Bacteria | 1905 |
| 7 | Ga0466708_066817 | 3300042652 | Bacteria | 5930 |
| 8 | IMNBL1DRAFT_c0003394 | 3300000062 | Bacteria | 10288 |
| 9 | Ga0466707_150969 | 3300042601 | Bacteria | 29136 |
| 10 | Ga0466707_418710 | 3300042601 | Bacteria | 3498 |
| 11 | Ga0466717_274538 | 3300042604 | Bacteria | 1796 |
| 12 | Ga0466715_015212 | 3300042616 | Bacteria | 6907 |
| 13 | Ga0466715_194603 | 3300042616 | Bacteria | 47231 |
| 14 | Ga0466726_048716 | 3300042619 | Bacteria | 3996 |
| 15 | Ga0466726_165838 | 3300042619 | Bacteria | 6943 |
| 16 | Ga0466733_187358 | 3300042659 | Bacteria | 6340 |
| 17 | Ga0123357_10336757 | 3300009784 | Bacteria | 1465 |
| 18 | Ga0123353_10145847 | 3300010167 | Bacteria | 3784 |
| 19 | Ga0123353_10307424 | 3300010167 | Bacteria | 2415 |
| 20 | Ga0466691_048684 | 3300042593 | Bacteria | 4911 |
| 21 | Ga0466691_081603 | 3300042593 | Bacteria | 26376 |
| 22 | Ga0466735_089686 | 3300042624 | Bacteria | 11865 |
| 23 | Ga0466735_187415 | 3300042624 | Bacteria | 1595 |
| 24 | Ga0466709_284062 | 3300042648 | Bacteria | 5408 |
| 25 | Ga0466724_41023 | 3300042649 | Bacteria | 2640 |
| 26 | Ga0466708_037354 | 3300042652 | Bacteria | 3112 |
| 27 | JGI24702J35022_10006606 | 3300002462 | Bacteria | 6697 |
| 28 | JGI24702J35022_10006949 | 3300002462 | Unclassified | 6508 |
| 29 | Ga0466701_078917 | 3300042598 | Bacteria | 7783 |
| 30 | Ga0466716_429462 | 3300042605 | Bacteria | 7173 |
| 31 | Ga0466719_330840 | 3300042606 | Bacteria | 4338 |
| 32 | Ga0466711_365823 | 3300042615 | Bacteria | 13020 |
| 33 | Ga0466711_384618 | 3300042615 | Bacteria | 22548 |
| 34 | Ga0466726_253610 | 3300042619 | Bacteria | 1445 |
| 35 | Ga0466697_167564 | 3300042611 | Bacteria | 10903 |
| 36 | Ga0466733_138584 | 3300042659 | Bacteria | 8998 |
| 37 | Ga0123353_10008324 | 3300010167 | Bacteria | 14147 |
| 38 | Ga0466735_181813 | 3300042624 | Bacteria | 1900 |
| 39 | Ga0466703_013908 | 3300042636 | Bacteria | 8602 |
| 40 | Ga0466703_135729 | 3300042636 | Bacteria | 12462 |
| 41 | Ga0466704_252042 | 3300042643 | Bacteria | 16478 |
| 42 | Ga0466709_248020 | 3300042648 | Bacteria | 6283 |
| 43 | Ga0466727_172844 | 3300042655 | Bacteria | 7424 |
| 44 | IMNBL1DRAFT_c0006837 | 3300000062 | Bacteria | 6139 |
| 45 | JGI24702J35022_10016164 | 3300002462 | Bacteria | 4095 |
| 46 | JGI24702J35022_10024361 | 3300002462 | Bacteria | 3271 |
| 47 | Ga0466701_095924 | 3300042598 | Bacteria | 1588 |
| 48 | Ga0466707_063453 | 3300042601 | Bacteria | 7168 |
| 49 | Ga0466716_347766 | 3300042605 | Bacteria | 17678 |
| 50 | Ga0466719_160806 | 3300042606 | Bacteria | 8437 |
| 51 | Ga0466719_378540 | 3300042606 | Bacteria | 3455 |
| 52 | Ga0466722_006441 | 3300042609 | Bacteria | 9912 |
| 53 | Ga0466722_012804 | 3300042609 | Bacteria | 32142 |
| 54 | Ga0466722_021911 | 3300042609 | Bacteria | 53346 |
| 55 | Ga0466715_042761 | 3300042616 | Bacteria | 45810 |
| 56 | Ga0466718_069150 | 3300042617 | Bacteria | 1416 |
| 57 | Ga0466723_335450 | 3300042618 | Bacteria | 9017 |
| 58 | Ga0466726_089813 | 3300042619 | Bacteria | 6693 |
| 59 | Ga0466732_232142 | 3300042656 | Bacteria | 5930 |
| 60 | Ga0123353_10000594 | 3300010167 | Bacteria | 44270 |
| 61 | Ga0123353_10001069 | 3300010167 | Bacteria | 33407 |
| 62 | Ga0123354_10083678 | 3300010882 | Bacteria | 4487 |
| 63 | Ga0466690_048418 | 3300042590 | Bacteria | 7719 |
| 64 | Ga0466692_013440 | 3300042591 | Bacteria | 17179 |
| 65 | Ga0466731_358898 | 3300042622 | Bacteria | 87251 |
| 66 | Ga0466703_021000 | 3300042636 | Bacteria | 8203 |
| 67 | Ga0466704_002372 | 3300042643 | Bacteria | 57196 |
| 68 | Ga0466704_021495 | 3300042643 | Bacteria | 17158 |
| 69 | Ga0466704_374722 | 3300042643 | Bacteria | 19201 |
| 70 | JGI24702J35022_10042718 | 3300002462 | Bacteria | 2414 |
| 71 | JGI24696J40584_12960642 | 3300002834 | Bacteria | 7898 |
| 72 | Ga0466706_017077 | 3300042599 | Bacteria | 10233 |
| 73 | Ga0466713_086346 | 3300042602 | Bacteria | 12025 |
| 74 | Ga0466698_328155 | 3300042610 | Bacteria | 1774 |
| 75 | Ga0466711_148907 | 3300042615 | Bacteria | 10787 |
| 76 | Ga0466711_213686 | 3300042615 | Bacteria | 7431 |
| 77 | Ga0466711_272661 | 3300042615 | Bacteria | 4675 |
| 78 | Ga0466723_010958 | 3300042618 | Bacteria | 5683 |
| 79 | Ga0466723_277765 | 3300042618 | Bacteria | 43175 |
| 80 | Ga0466726_312321 | 3300042619 | Bacteria | 1659 |
| 81 | Ga0466728_278714 | 3300042620 | Bacteria | 5281 |
| 82 | Ga0466705_191068 | 3300042612 | Bacteria | 8850 |
| 83 | Ga0123356_10038011 | 3300010049 | Bacteria | 4488 |
| 84 | Ga0123354_10001016 | 3300010882 | Bacteria | 32074 |
| 85 | Ga0466656_120950 | 3300042550 | Bacteria | 9575 |
| 86 | Ga0466690_087674 | 3300042590 | Bacteria | 3777 |
| 87 | Ga0466690_159618 | 3300042590 | Bacteria | 13151 |
| 88 | Ga0466693_081870 | 3300042592 | Bacteria | 3434 |
| 89 | Ga0466693_344935 | 3300042592 | Bacteria | 4143 |
| 90 | Ga0466691_028335 | 3300042593 | Bacteria | 20105 |
| 91 | Ga0466702_345415 | 3300042635 | Bacteria | 2239 |
| 92 | Ga0466709_159378 | 3300042648 | Unclassified | 18288 |
| 93 | IMNBL1DRAFT_c0001686 | 3300000062 | Bacteria | 16300 |
| 94 | JGI24705J35276_12237354 | 3300002504 | Bacteria | 10794 |
| 95 | JGI24696J40584_12961651 | 3300002834 | Bacteria | 28246 |
| 96 | Ga0466701_031057 | 3300042598 | Bacteria | 34075 |
| 97 | Ga0466707_376420 | 3300042601 | Bacteria | 22118 |
| 98 | Ga0466722_125521 | 3300042609 | Bacteria | 16603 |
| 99 | Ga0466722_240676 | 3300042609 | Bacteria | 6364 |
| 100 | Ga0466715_125107 | 3300042616 | Bacteria | 14722 |
| 101 | Ga0466715_503781 | 3300042616 | Bacteria | 29674 |
| 102 | Ga0466728_289451 | 3300042620 | Bacteria | 3826 |
| 103 | Ga0466733_212465 | 3300042659 | Bacteria | 4832 |
| 104 | Ga0123353_10649737 | 3300010167 | Bacteria | 1493 |
| 105 | Ga0123354_10172874 | 3300010882 | Bacteria | 2505 |
| 106 | Ga0466690_313164 | 3300042590 | Bacteria | 2366 |
| 107 | Ga0466696_091816 | 3300042596 | Bacteria | 11965 |
| 108 | Ga0466729_268864 | 3300042621 | Bacteria | 19528 |
| 109 | Ga0466702_009416 | 3300042635 | Bacteria | 1281 |
| 110 | Ga0466704_024801 | 3300042643 | Bacteria | 23494 |
| 111 | Ga0466709_273462 | 3300042648 | Bacteria | 4001 |
| 112 | Ga0466708_130167 | 3300042652 | Bacteria | 53436 |
| 113 | Ga0466727_051328 | 3300042655 | Bacteria | 9580 |
| 114 | Ga0068305_10057746 | 3300005083 | Unclassified | 11121 |
| 115 | Ga0466713_038812 | 3300042602 | Bacteria | 13025 |
| 116 | Ga0466722_139334 | 3300042609 | Bacteria | 3070 |
| 117 | Ga0466712_298084 | 3300042614 | Bacteria | 4121 |
| 118 | Ga0466715_388028 | 3300042616 | Bacteria | 11694 |
| 119 | Ga0466723_320199 | 3300042618 | Bacteria | 12571 |
| 120 | Ga0466726_172879 | 3300042619 | Bacteria | 6101 |
| 121 | Ga0466705_256370 | 3300042612 | Bacteria | 21200 |
| 122 | Ga0123357_10068273 | 3300009784 | Bacteria | 4731 |
| 123 | Ga0123356_10169799 | 3300010049 | Bacteria | 2190 |
| 124 | Ga0123353_10498364 | 3300010167 | Bacteria | 1775 |
| 125 | Ga0466693_289132 | 3300042592 | Bacteria | 2591 |
| 126 | Ga0466694_357625 | 3300042594 | Bacteria | 1500 |
| 127 | Ga0466724_31500 | 3300042649 | Bacteria | 3539 |
| 128 | Ga0466708_060683 | 3300042652 | Bacteria | 49198 |
| 129 | Ga0466727_093739 | 3300042655 | Bacteria | 17800 |
| 130 | 2227571863 | 2225789004 | Bacteria | 13781 |
| 131 | JGI24702J35022_10056318 | 3300002462 | Bacteria | 2097 |
| 132 | JGI24696J40584_12961687 | 3300002834 | Bacteria | 36323 |
| 133 | Ga0123357_10001720 | 3300009784 | Bacteria | 23612 |
| 134 | Ga0466701_102020 | 3300042598 | Bacteria | 4481 |
| 135 | Ga0466717_113072 | 3300042604 | Bacteria | 2226 |
| 136 | Ga0466719_029723 | 3300042606 | Bacteria | 13054 |
| 137 | Ga0466705_437923 | 3300042612 | Bacteria | 14795 |
| 138 | Ga0466711_373559 | 3300042615 | Bacteria | 1794 |
| 139 | Ga0466715_087695 | 3300042616 | Bacteria | 3523 |
| 140 | Ga0466728_138171 | 3300042620 | Bacteria | 48750 |
| 141 | Ga0466705_105693 | 3300042612 | Bacteria | 24317 |
| 142 | Ga0466705_267691 | 3300042612 | Bacteria | 7907 |
| 143 | Ga0123356_10048427 | 3300010049 | Bacteria | 3956 |
| 144 | Ga0123356_10399586 | 3300010049 | Bacteria | 1511 |
| 145 | Ga0123353_10104475 | 3300010167 | Bacteria | 4565 |
| 146 | Ga0123354_10168668 | 3300010882 | Bacteria | 2559 |
| 147 | Ga0415639_077064 | 3300038395 | Bacteria | 2743 |
| 148 | Ga0466657_389727 | 3300042582 | Bacteria | 2347 |
| 149 | Ga0466690_126381 | 3300042590 | Bacteria | 12143 |
| 150 | Ga0466692_001428 | 3300042591 | Bacteria | 2263 |
| 151 | Ga0466696_120177 | 3300042596 | Bacteria | 12396 |
| 152 | Ga0466696_305108 | 3300042596 | Bacteria | 6709 |
| 153 | Ga0466696_340248 | 3300042596 | Bacteria | 11516 |
| 154 | Ga0466734_160465 | 3300042623 | Bacteria | 1516 |
| 155 | Ga0466703_399369 | 3300042636 | Bacteria | 29558 |
| 156 | Ga0466704_163818 | 3300042643 | Bacteria | 2579 |
| 157 | JGI24702J35022_10000054 | 3300002462 | Bacteria | 48095 |
| 158 | JGI24702J35022_10007616 | 3300002462 | Bacteria | 6194 |
| 159 | Ga0123357_10000257 | 3300009784 | Bacteria | 50946 |
| 160 | Ga0466713_017736 | 3300042602 | Bacteria | 49462 |
| 161 | Ga0466713_117267 | 3300042602 | Bacteria | 44157 |
| 162 | Ga0466717_270688 | 3300042604 | Bacteria | 1700 |
| 163 | Ga0466716_257662 | 3300042605 | Bacteria | 29731 |
| 164 | Ga0466710_372730 | 3300042613 | Bacteria | 6189 |
| 165 | Ga0466728_450661 | 3300042620 | Unclassified | 7822 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00501 | AMP-binding | AMP-binding enzyme | 73 | 288 | 0.77 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.