Protein Family IF07491
Metagenome
Isolate
119
Members
54
Samples
112
Scaffolds
230.72
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_131560|Ga0466711_131560_1339_2166
- Length
- 275 aa
- Sequence
- MVRRRISFCVKASAKRFFEVLCAKRNKLLALPQLPGYTVFVAILYVIGTPIGNLGDLSFRAVEILKSAELVACEDTRQTLKLLSHFGISVKMLSCRAQNEKFAAEKVIAALREGKTVAYASDAGTPALSDPGAVLARKAAEAGFEVIPIPGPSAFASLVSVAGGIDKSVLFEGFLSPKPGRRRSRLRELLDGEFAFVLYESPFRILKLLADLADLDSERYICVAREMTKVHEEYLRGPAGEIYLFLAERAKKNEIRGEFSVYVSGRSRNHLFGDF
Sample Types
Isolate
5.9%
Metagenome
94.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.4%
Kalotermitidae
22.2%
Unclassified
18.5%
Rhinotermitidae
7.4%
Termopsidae
5.6%
Hodotermitidae
1.9%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 4 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 5 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 9 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 10 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 23 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 24 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 25 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 28 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 29 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 30 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 42 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 45 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 50 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_034938 | 3300042612 | Unclassified | 3769 |
| 2 | Ga0466732_108670 | 3300042656 | Unclassified | 1199 |
| 3 | Ga0466733_074839 | 3300042659 | Bacteria | 2380 |
| 4 | AustNasuHG_c1046107 | 3300000089 | Bacteria | 988 |
| 5 | Ga0466712_152139 | 3300042614 | Bacteria | 3653 |
| 6 | Ga0466718_081111 | 3300042617 | Bacteria | 12231 |
| 7 | Ga0466706_004160 | 3300042599 | Bacteria | 1120 |
| 8 | Ga0466716_485234 | 3300042605 | Bacteria | 1584 |
| 9 | Ga0466722_029983 | 3300042609 | Bacteria | 3510 |
| 10 | Ga0466690_323809 | 3300042590 | Unclassified | 3773 |
| 11 | Ga0466692_064752 | 3300042591 | Bacteria | 30509 |
| 12 | Ga0466709_316699 | 3300042648 | Bacteria | 1654 |
| 13 | JGI24698J34947_10058909 | 3300002449 | Unclassified | 1900 |
| 14 | JGI24695J34938_10028926 | 3300002450 | Bacteria | 2596 |
| 15 | Ga0466715_007374 | 3300042616 | Bacteria | 12368 |
| 16 | Ga0466723_142689 | 3300042618 | Bacteria | 7170 |
| 17 | Ga0466721_220378 | 3300042608 | Bacteria | 49670 |
| 18 | Ga0466690_355312 | 3300042590 | Bacteria | 7657 |
| 19 | Ga0466693_219252 | 3300042592 | Bacteria | 11724 |
| 20 | Ga0123356_10780069 | 3300010049 | Bacteria | 1126 |
| 21 | Ga0466729_213877 | 3300042621 | Bacteria | 3205 |
| 22 | Ga0466729_249079 | 3300042621 | Unclassified | 1839 |
| 23 | Ga0466735_134686 | 3300042624 | Bacteria | 2240 |
| 24 | JGI24705J35276_12230847 | 3300002504 | Bacteria | 3755 |
| 25 | Ga0068305_10289765 | 3300005083 | Bacteria | 25702 |
| 26 | Ga0466723_318631 | 3300042618 | Bacteria | 5343 |
| 27 | Ga0466700_388789 | 3300042600 | Bacteria | 1524 |
| 28 | Ga0466692_023655 | 3300042591 | Bacteria | 4658 |
| 29 | Ga0466699_312039 | 3300042597 | Bacteria | 1392 |
| 30 | Ga0123353_10919047 | 3300010167 | Bacteria | 1188 |
| 31 | Ga0466735_209327 | 3300042624 | Unclassified | 1149 |
| 32 | Ga0466727_205175 | 3300042655 | Bacteria | 3034 |
| 33 | JGI24702J35022_10012147 | 3300002462 | Bacteria | 4793 |
| 34 | JGI24702J35022_10173682 | 3300002462 | Bacteria | 1220 |
| 35 | Ga0466711_131560 | 3300042615 | Bacteria | 7269 |
| 36 | Ga0466711_502192 | 3300042615 | Bacteria | 57733 |
| 37 | Ga0466715_249736 | 3300042616 | Bacteria | 2763 |
| 38 | Ga0466715_327274 | 3300042616 | Bacteria | 11914 |
| 39 | Ga0466715_611324 | 3300042616 | Unclassified | 4688 |
| 40 | Ga0466726_338994 | 3300042619 | Bacteria | 2685 |
| 41 | Ga0466706_086381 | 3300042599 | Bacteria | 5128 |
| 42 | Ga0466707_176237 | 3300042601 | Bacteria | 1170 |
| 43 | Ga0466722_057028 | 3300042609 | Bacteria | 4739 |
| 44 | Ga0466722_088590 | 3300042609 | Bacteria | 1783 |
| 45 | Ga0466699_034054 | 3300042597 | Bacteria | 1129 |
| 46 | Ga0123357_10024115 | 3300009784 | Bacteria | 8184 |
| 47 | Ga0123357_10109099 | 3300009784 | Bacteria | 3537 |
| 48 | Ga0123353_11694566 | 3300010167 | Bacteria | 792 |
| 49 | Ga0466734_020264 | 3300042623 | Bacteria | 1011 |
| 50 | Ga0466735_174917 | 3300042624 | Bacteria | 1669 |
| 51 | Ga0466727_173488 | 3300042655 | Bacteria | 1166 |
| 52 | Ga0466705_029928 | 3300042612 | Bacteria | 5320 |
| 53 | Ga0466732_073783 | 3300042656 | Bacteria | 2112 |
| 54 | JGI24695J34938_10022613 | 3300002450 | Bacteria | 3049 |
| 55 | Ga0466712_031442 | 3300042614 | Bacteria | 10643 |
| 56 | Ga0466711_291871 | 3300042615 | Bacteria | 3888 |
| 57 | Ga0466711_386271 | 3300042615 | Bacteria | 1067 |
| 58 | Ga0466715_084688 | 3300042616 | Bacteria | 4250 |
| 59 | Ga0466715_429864 | 3300042616 | Bacteria | 2141 |
| 60 | Ga0466726_126497 | 3300042619 | Bacteria | 1054 |
| 61 | Ga0466700_180384 | 3300042600 | Bacteria | 1630 |
| 62 | Ga0466720_045926 | 3300042607 | Bacteria | 6379 |
| 63 | Ga0466699_044258 | 3300042597 | Bacteria | 1669 |
| 64 | Ga0123353_10206885 | 3300010167 | Bacteria | 3082 |
| 65 | Ga0466712_307452 | 3300042614 | Bacteria | 1460 |
| 66 | Ga0466711_213064 | 3300042615 | Unclassified | 10022 |
| 67 | Ga0466715_353453 | 3300042616 | Bacteria | 11473 |
| 68 | Ga0466728_149690 | 3300042620 | Bacteria | 3470 |
| 69 | Ga0415639_043582 | 3300038395 | Unclassified | 3735 |
| 70 | Ga0456237_0002822 | 3300041968 | Bacteria | 2814 |
| 71 | Ga0466691_101531 | 3300042593 | Bacteria | 3193 |
| 72 | Ga0123357_10389114 | 3300009784 | Bacteria | 1284 |
| 73 | Ga0123355_10048998 | 3300009826 | Bacteria | 6869 |
| 74 | Ga0466731_420299 | 3300042622 | Bacteria | 1548 |
| 75 | Ga0466735_206986 | 3300042624 | Unclassified | 2303 |
| 76 | Ga0466703_235569 | 3300042636 | Bacteria | 46354 |
| 77 | Ga0466704_565861 | 3300042643 | Bacteria | 62930 |
| 78 | JGI24702J35022_10359197 | 3300002462 | Bacteria | 872 |
| 79 | JGI24696J40584_12906502 | 3300002834 | Bacteria | 1221 |
| 80 | Ga0466715_616220 | 3300042616 | Unclassified | 1514 |
| 81 | Ga0466718_101351 | 3300042617 | Bacteria | 2451 |
| 82 | Ga0466706_276692 | 3300042599 | Bacteria | 2035 |
| 83 | Ga0466693_161889 | 3300042592 | Bacteria | 6787 |
| 84 | Ga0466694_040298 | 3300042594 | Bacteria | 14270 |
| 85 | Ga0123353_10039147 | 3300010167 | Bacteria | 7459 |
| 86 | Ga0123353_10049375 | 3300010167 | Bacteria | 6702 |
| 87 | Ga0123353_10511274 | 3300010167 | Bacteria | 1746 |
| 88 | Ga0466704_166784 | 3300042643 | Bacteria | 45771 |
| 89 | Ga0466704_287894 | 3300042643 | Bacteria | 4407 |
| 90 | Ga0466709_164978 | 3300042648 | Bacteria | 16343 |
| 91 | Ga0466705_038113 | 3300042612 | Bacteria | 3302 |
| 92 | Ga0466705_179514 | 3300042612 | Bacteria | 6721 |
| 93 | Ga0466733_054432 | 3300042659 | Bacteria | 1704 |
| 94 | Ga0466733_196071 | 3300042659 | Bacteria | 21254 |
| 95 | Ga0466712_004660 | 3300042614 | Bacteria | 2750 |
| 96 | Ga0466712_031663 | 3300042614 | Bacteria | 1432 |
| 97 | Ga0466711_208392 | 3300042615 | Bacteria | 8698 |
| 98 | Ga0466723_089616 | 3300042618 | Bacteria | 39215 |
| 99 | Ga0466723_369640 | 3300042618 | Bacteria | 2974 |
| 100 | Ga0466707_283813 | 3300042601 | Bacteria | 1059 |
| 101 | Ga0466713_146461 | 3300042602 | Bacteria | 3180 |
| 102 | Ga0466722_190212 | 3300042609 | Bacteria | 2111 |
| 103 | Ga0415639_029983 | 3300038395 | Bacteria | 1385 |
| 104 | Ga0466692_090856 | 3300042591 | Bacteria | 20722 |
| 105 | Ga0123356_10901286 | 3300010049 | Bacteria | 1055 |
| 106 | Ga0123353_10089090 | 3300010167 | Bacteria | 4969 |
| 107 | Ga0123353_10661569 | 3300010167 | Bacteria | 1476 |
| 108 | Ga0123353_10928913 | 3300010167 | Bacteria | 1180 |
| 109 | Ga0123354_10513445 | 3300010882 | Bacteria | 926 |
| 110 | Ga0466735_146592 | 3300042624 | Bacteria | 1861 |
| 111 | Ga0466708_004611 | 3300042652 | Bacteria | 24859 |
| 112 | Ga0466708_025900 | 3300042652 | Bacteria | 14574 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00590 | TP_methylase | Tetrapyrrole (Corrin/Porphyrin) Methylases | 44 | 242 | 0.9 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00590 | GO:0008168 | methyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.