Protein Family IF07415

Metagenome Isolate
245 Members
65 Samples
221 Scaffolds
444.94 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_245594|Ga0466712_245594_11590_12993
Length
467 aa
Sequence
MAQGLKDKTPPHDDELEQAALGSLLADNEAVTAAIQLHLRPGDFYSRANTRIYEAVLSLDAKGLRPDIQTVVQELKQMGKLDEAGGASYVSSLTTVIPSSANIDYYAQMVKNYSVKRSLLKVASKIGINAYDESKDSREVLEDVQQSIFELTDDGQVFSARKIREVLKETIDLLDNAMKSKSAITGIPTGFDKLDQMTSGFQRDEFIIIGARPSVGKTALALNMAANIAFHKKIPTAFFSLEMSDIALVQRLISSEAMVKAQNLRTGFLSSDDYRKVVDVMSVIYEAPFHIVDMPNMKLLDLRAQARKMRSQQQVQIIFIDYLGLVGHENNALPRYEQISEISRSLKSLARELHIPVVVLCQLNRDAQREAPTLANLRDSGSIEQDADLVLFLNREQTRKNRKXXXXESHMPLDTIPTDLIIAKQRNGPIGVVKLELVTKFAKFTALAKERYPDGNLRNADIQEEMS

📊 Sample Types

Isolate 9.8%
Metagenome 90.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.3%
Unclassified 38.1%
Kalotermitidae 14.3%
Rhinotermitidae 4.8%
Termopsidae 1.6%

🌳 Taxonomy

Archaea 2
Bacteria 222
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
2 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
3 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
7 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
8 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
9 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
10 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
11 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
12 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
13 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
14 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
15 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
16 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
17 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
18 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
19 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
20 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
21 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
22 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
23 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
26 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
27 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
28 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
29 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
30 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
31 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
32 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
33 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
34 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
35 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
38 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
39 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
40 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
41 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
42 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
43 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
44 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
45 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
46 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
47 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
48 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
49 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
50 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
51 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
52 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
53 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
54 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
55 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
56 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
57 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
58 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
59 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
60 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
61 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
62 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
63 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
64 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
65 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_035013 3300042614 Bacteria 3905
2 Ga0466712_320900 3300042614 Unclassified 2652
3 Ga0466715_042722 3300042616 Unclassified 11407
4 Ga0466715_543439 3300042616 Bacteria 2859
5 Ga0466718_007995 3300042617 Bacteria 2022
6 Ga0466718_066637 3300042617 Bacteria 8036
7 Ga0466718_091605 3300042617 Bacteria 29541
8 Ga0466718_148910 3300042617 Bacteria 34374
9 Ga0264413_117748 3300024493 Bacteria 13996
10 Ga0466699_021544 3300042597 Bacteria 70828
11 Ga0466699_074019 3300042597 Bacteria 9349
12 Ga0466699_216026 3300042597 Bacteria 10645
13 Ga0466720_049087 3300042607 Bacteria 7543
14 Ga0466720_115616 3300042607 Bacteria 7017
15 Ga0466720_182957 3300042607 Bacteria 3994
16 Ga0466721_002118 3300042608 Bacteria 35712
17 Ga0123356_10000052 3300010049 Bacteria 124725
18 Ga0123356_10015672 3300010049 Bacteria 7258
19 Ga0123356_10016123 3300010049 Bacteria 7139
20 JGI24698J34947_10005662 3300002449 Bacteria 6850
21 JGI24698J34947_10016900 3300002449 Unclassified 3959
22 JGI24695J34938_10002961 3300002450 Bacteria 12256
23 JGI24695J34938_10006478 3300002450 Bacteria 7015
24 Ga0072940_1020808 3300005200 Bacteria 3598
25 Ga0466702_294150 3300042635 Bacteria 2431
26 Ga0466702_388186 3300042635 Bacteria 5280
27 Ga0466705_063090 3300042612 Bacteria 5677
28 Ga0466712_066353 3300042614 Bacteria 17178
29 Ga0466712_127991 3300042614 Bacteria 14153
30 Ga0466712_245594 3300042614 Bacteria 24408
31 Ga0466718_029826 3300042617 Bacteria 2288
32 Ga0466718_076227 3300042617 Bacteria 4911
33 Ga0264413_115579 3300024493 Bacteria 4970
34 Ga0415639_023672 3300038395 Bacteria 14328
35 Ga0466690_044770 3300042590 Unclassified 7248
36 Ga0466699_106226 3300042597 Bacteria 6384
37 Ga0466717_261915 3300042604 Archaea 2125
38 Ga0466719_390576 3300042606 Bacteria 14580
39 Ga0466720_021151 3300042607 Bacteria 15669
40 Ga0466722_104112 3300042609 Bacteria 1589
41 Ga0123356_10002539 3300010049 Bacteria 19514
42 Ga0123356_10060584 3300010049 Bacteria 3532
43 JGI24698J34947_10000094 3300002449 Bacteria 30023
44 JGI24695J34938_10000095 3300002450 Bacteria 77781
45 JGI24695J34938_10000203 3300002450 Bacteria 56250
46 JGI24695J34938_10000229 3300002450 Bacteria 53063
47 JGI24695J34938_10000794 3300002450 Bacteria 29386
48 JGI24695J34938_10002529 3300002450 Bacteria 13840
49 JGI24695J34938_10002852 3300002450 Bacteria 12593
50 JGI24695J34938_10007286 3300002450 Bacteria 6513
51 JGI24695J34938_10011809 3300002450 Bacteria 4680
52 JGI24695J34938_10023839 3300002450 Bacteria 2945
53 JGI24695J34938_10030075 3300002450 Bacteria 2533
54 Ga0466702_448151 3300042635 Bacteria 3349
55 Ga0466732_146163 3300042656 Bacteria 9798
56 Ga0466712_132203 3300042614 Bacteria 15768
57 Ga0466712_257537 3300042614 Bacteria 2431
58 Ga0415639_101310 3300038395 Bacteria 12566
59 Ga0466692_061589 3300042591 Unclassified 4210
60 Ga0466692_107737 3300042591 Bacteria 2274
61 Ga0466693_075896 3300042592 Bacteria 53125
62 Ga0466694_114928 3300042594 Bacteria 30404
63 Ga0466694_249777 3300042594 Bacteria 6932
64 Ga0466699_237898 3300042597 Bacteria 13519
65 Ga0466720_032731 3300042607 Bacteria 15887
66 Ga0466722_103348 3300042609 Bacteria 5698
67 Ga0123356_10092701 3300010049 Bacteria 2881
68 AustNasuHG_c1005043 3300000089 Unclassified 4722
69 AustNasuHG_c1005587 3300000089 Bacteria 4498
70 JGI24698J34947_10001586 3300002449 Bacteria 12059
71 JGI24698J34947_10008279 3300002449 Unclassified 5700
72 JGI24698J34947_10012450 3300002449 Bacteria 4662
73 JGI24695J34938_10000108 3300002450 Bacteria 73543
74 JGI24695J34938_10001011 3300002450 Bacteria 25489
75 JGI24695J34938_10010941 3300002450 Bacteria 4926
76 Ga0072941_1004855 3300005201 Bacteria 18447
77 Ga0072941_1043339 3300005201 Bacteria 6252
78 Ga0466702_443012 3300042635 Bacteria 1783
79 Ga0466732_382322 3300042656 Bacteria 14917
80 Ga0466712_008391 3300042614 Unclassified 9845
81 Ga0466712_023710 3300042614 Unclassified 3360
82 Ga0466718_113130 3300042617 Unclassified 3245
83 Ga0466718_141681 3300042617 Bacteria 13736
84 Ga0466694_006279 3300042594 Bacteria 29816
85 Ga0466694_040287 3300042594 Bacteria 36169
86 Ga0466694_232930 3300042594 Bacteria 11790
87 Ga0466699_173478 3300042597 Bacteria 4287
88 Ga0466699_309109 3300042597 Bacteria 4954
89 Ga0123356_10000565 3300010049 Bacteria 41206
90 Ga0123356_10018626 3300010049 Bacteria 6588
91 2230954228 2228664003 Bacteria 8872
92 JGI24698J34947_10012000 3300002449 Bacteria 4757
93 JGI24698J34947_10043631 3300002449 Bacteria 2298
94 JGI24695J34938_10000763 3300002450 Bacteria 30255
95 JGI24695J34938_10001326 3300002450 Bacteria 21394
96 Ga0072941_1049611 3300005201 Bacteria 5056
97 Ga0072941_1145652 3300005201 Bacteria 4854
98 Ga0466730_018875 3300042625 Bacteria 1576
99 Ga0466732_246759 3300042656 Bacteria 6599
100 Ga0466712_038897 3300042614 Bacteria 3398
101 Ga0466712_195101 3300042614 Bacteria 17668
102 Ga0466712_209554 3300042614 Bacteria 30568
103 Ga0264413_100812 3300024493 Bacteria 11454
104 Ga0264413_101506 3300024493 Unclassified 6303
105 Ga0466692_016075 3300042591 Bacteria 5190
106 Ga0466694_192586 3300042594 Bacteria 2394
107 Ga0466699_104268 3300042597 Bacteria 14934
108 Ga0466699_237511 3300042597 Bacteria 7226
109 Ga0466720_078453 3300042607 Bacteria 15244
110 Ga0466720_127049 3300042607 Bacteria 8394
111 Ga0466722_089421 3300042609 Bacteria 13077
112 Ga0466722_135542 3300042609 Bacteria 3374
113 Ga0466698_026374 3300042610 Bacteria 12803
114 Ga0123356_10000032 3300010049 Bacteria 154381
115 Ga0123356_10017706 3300010049 Bacteria 6771
116 Ga0123353_10279153 3300010167 Bacteria 2567
117 AustNasuHG_c1000031 3300000089 Bacteria 33623
118 AustNasuHG_c1004542 3300000089 Bacteria 4978
119 JGI24695J34938_10000043 3300002450 Bacteria 94696
120 JGI24695J34938_10003863 3300002450 Bacteria 10153
121 JGI24695J34938_10004013 3300002450 Bacteria 9903
122 JGI24695J34938_10004438 3300002450 Bacteria 9195
123 JGI24695J34938_10008851 3300002450 Unclassified 5687
124 JGI24697J35500_11262801 3300002507 Bacteria 3159
125 Ga0072940_1035794 3300005200 Unclassified 16352
126 Ga0072941_1003865 3300005201 Bacteria 32964
127 Ga0072941_1008944 3300005201 Bacteria 13070
128 Ga0072941_1094389 3300005201 Bacteria 2666
129 Ga0466731_098436 3300042622 Bacteria 4421
130 Ga0466702_040033 3300042635 Bacteria 1691
131 Ga0466702_106066 3300042635 Bacteria 27037
132 Ga0466704_324299 3300042643 Bacteria 17934
133 Ga0466712_106376 3300042614 Bacteria 7574
134 Ga0466712_227743 3300042614 Bacteria 1716
135 Ga0466712_243936 3300042614 Bacteria 12276
136 Ga0466712_254917 3300042614 Bacteria 7532
137 Ga0466718_036913 3300042617 Unclassified 3237
138 Ga0466718_077982 3300042617 Bacteria 2838
139 Ga0466718_166608 3300042617 Unclassified 6434
140 Ga0264413_102583 3300024493 Unclassified 9133
141 Ga0415639_021263 3300038395 Bacteria 30338
142 Ga0456237_0004240 3300041968 Bacteria 2307
143 Ga0466692_065475 3300042591 Bacteria 4026
144 Ga0466691_039302 3300042593 Bacteria 18294
145 Ga0466694_265779 3300042594 Bacteria 6736
146 Ga0466695_061335 3300042595 Bacteria 29701
147 Ga0466720_157755 3300042607 Bacteria 10734
148 Ga0466722_036243 3300042609 Bacteria 10913
149 Ga0123356_10007721 3300010049 Bacteria 10712
150 Ga0123356_10010939 3300010049 Bacteria 8865
151 Ga0123356_10315239 3300010049 Bacteria 1675
152 Ga0123353_10009560 3300010167 Bacteria 13404
153 AustNasuHG_c1016959 3300000089 Bacteria 2430
154 JGI24698J34947_10022793 3300002449 Unclassified 3353
155 JGI24698J34947_10036819 3300002449 Bacteria 2545
156 JGI24695J34938_10000019 3300002450 Bacteria 113818
157 JGI24695J34938_10000074 3300002450 Bacteria 84540
158 JGI24695J34938_10001301 3300002450 Bacteria 21804
159 JGI24695J34938_10001483 3300002450 Bacteria 19815
160 JGI24695J34938_10008125 3300002450 Bacteria 6039
161 JGI24695J34938_10014658 3300002450 Bacteria 4054
162 Ga0466708_363067 3300042652 Bacteria 2433
163 Ga0466712_012911 3300042614 Unclassified 11643
164 Ga0466712_014446 3300042614 Bacteria 4540
165 Ga0466712_019222 3300042614 Bacteria 20837
166 Ga0466712_026949 3300042614 Bacteria 25702
167 Ga0466712_084706 3300042614 Bacteria 14068
168 Ga0466711_334890 3300042615 Bacteria 3209
169 Ga0466715_087930 3300042616 Bacteria 17789
170 Ga0466718_107635 3300042617 Bacteria 4226
171 Ga0466718_152662 3300042617 Bacteria 4410
172 Ga0466723_155126 3300042618 Bacteria 10663
173 Ga0264413_123133 3300024493 Bacteria 8005
174 Ga0466692_031911 3300042591 Bacteria 6917
175 Ga0466694_306729 3300042594 Bacteria 8726
176 Ga0466719_444651 3300042606 Bacteria 35344
177 Ga0466722_076183 3300042609 Bacteria 10696
178 Ga0466722_138773 3300042609 Bacteria 7714
179 Ga0466722_227561 3300042609 Bacteria 12906
180 Ga0466722_252461 3300042609 Bacteria 3051
181 Ga0123355_10013606 3300009826 Bacteria 12674
182 Ga0123356_10000525 3300010049 Bacteria 42550
183 Ga0123356_10001169 3300010049 Bacteria 29033
184 JGI24698J34947_10016542 3300002449 Unclassified 4001
185 JGI24695J34938_10000066 3300002450 Bacteria 87156
186 JGI24695J34938_10003770 3300002450 Bacteria 10337
187 JGI24695J34938_10011002 3300002450 Bacteria 4910
188 JGI24695J34938_10011291 3300002450 Bacteria 4818
189 JGI24695J34938_10014892 3300002450 Bacteria 4009
190 Ga0072940_1036196 3300005200 Archaea 4277
191 Ga0072941_1010653 3300005201 Unclassified 1791
192 Ga0072941_1049029 3300005201 Bacteria 6884
193 Ga0074263_110027 3300005485 Bacteria 1695
194 Ga0466702_191272 3300042635 Bacteria 19326
195 Ga0466732_006924 3300042656 Bacteria 5351
196 Ga0466712_007985 3300042614 Bacteria 81055
197 Ga0466712_232783 3300042614 Bacteria 15480
198 Ga0466718_086059 3300042617 Bacteria 4026
199 Ga0264413_100787 3300024493 Bacteria 17408
200 Ga0415639_010511 3300038395 Bacteria 18297
201 Ga0466692_132543 3300042591 Bacteria 3133
202 Ga0466693_272064 3300042592 Bacteria 25117
203 Ga0466694_043546 3300042594 Bacteria 51657
204 Ga0466694_075429 3300042594 Bacteria 19168
205 Ga0466699_057682 3300042597 Bacteria 7503
206 Ga0466700_276552 3300042600 Bacteria 5184
207 Ga0123356_10018744 3300010049 Bacteria 6568
208 Ga0123356_10169937 3300010049 Bacteria 2190
209 Ga0123353_10343637 3300010167 Bacteria 2253
210 JGI24698J34947_10000681 3300002449 Bacteria 16593
211 JGI24695J34938_10000101 3300002450 Bacteria 74732
212 JGI24695J34938_10000830 3300002450 Bacteria 28741
213 JGI24695J34938_10001346 3300002450 Bacteria 21222
214 JGI24695J34938_10003496 3300002450 Bacteria 10919
215 JGI24697J35500_11274592 3300002507 Bacteria 8007
216 Ga0072941_1061663 3300005201 Bacteria 6136
217 Ga0072941_1094388 3300005201 Bacteria 2664
218 Ga0466702_066384 3300042635 Bacteria 8377
219 Ga0466702_069960 3300042635 Bacteria 24936
220 Ga0466702_450564 3300042635 Bacteria 5063
221 Ga0466727_053987 3300042655 Unclassified 7444

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00772 DnaB DnaB-like helicase N terminal domain 10 111 0.95
PF03796 DnaB_C DnaB-like helicase C terminal domain 186 445 0.94
PF13481 AAA_25 AAA domain 196 366 0.82

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.