Protein Family IF07398
Metagenome
Isolate
252
Members
82
Samples
219
Scaffolds
241.36
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_201837|Ga0466712_201837_18629_19483
- Length
- 284 aa
- Sequence
- VLKNYQYSWYTQSGNLASGPAYIHPEDFPHIITRFNIEEQNYLYGVFMLRIEHLTKTYGDKKAVDDLSLDIADGEICGFIGPNGAGKTTTIKSVCGILGFDSGEIYIGEKSIRREPIECKRRMAYIPDNPDLYDFLSGIKYLNFIADVYGIGVTERQERIRLYADMFELTADLAQPIAAYSHGMKQKLALISAFIHEPEFLVLDEPFVGLDPMASRVVKDLMRKKCDGGGAVFFSTHILEVAEKLCDKVAIIKNGRLVAWGDMDKVRGDGSLEKVFFELEEGKA
Sample Types
Isolate
13.1%
Metagenome
86.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Unclassified
32.1%
Kalotermitidae
13.6%
Passalidae
3.7%
Blattidae
3.7%
Termopsidae
3.7%
Stratiomyidae
2.5%
Rhinotermitidae
2.5%
Hydrophilidae
1.2%
Dytiscidae
1.2%
Formicidae
1.2%
Hodotermitidae
1.2%
Taxonomy
Archaea
3
Bacteria
242
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 2 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 3 | 2820403592 | Unclassified Firmicutes Lab288P4bin93 | Isolate | Unclassified |
| 4 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 5 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 6 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 7 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 8 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 9 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 10 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 11 | 2820249082 | Unclassified Firmicutes Th196P3bin69 | Isolate | Unclassified |
| 12 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 13 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 14 | 2820476618 | Unclassified Firmicutes Lab288P1bin80 | Isolate | Unclassified |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 17 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 26 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 27 | 2963635624 | Unclassified Bacilli bacterium PM5-9 | Isolate | Blattidae |
| 28 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 29 | 2820679524 | Unclassified Firmicutes Co191P1bin94 | Isolate | Unclassified |
| 30 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 31 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 36 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 37 | 2820477775 | Unclassified Firmicutes Lab288P1bin79 | Isolate | Unclassified |
| 38 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 39 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 44 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 45 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 46 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 47 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 48 | 2820565217 | Unclassified Firmicutes Emb289P3bin51 | Isolate | Unclassified |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 51 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 52 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 53 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 54 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 55 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 56 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 57 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 58 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 59 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 60 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 61 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 62 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 63 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 64 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 65 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 66 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 67 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 68 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 69 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 70 | 2963634138 | Unclassified Bacilli bacterium PM5-3 | Isolate | Blattidae |
| 71 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 72 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 73 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 74 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 75 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 76 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 77 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 78 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 79 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 80 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 81 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 82 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10583145 | 3300009784 | Bacteria | 870 |
| 2 | Ga0123355_10117979 | 3300009826 | Bacteria | 4125 |
| 3 | Ga0123353_10018186 | 3300010167 | Bacteria | 10379 |
| 4 | Ga0123353_10175688 | 3300010167 | Bacteria | 3396 |
| 5 | Ga0123353_10248712 | 3300010167 | Bacteria | 2756 |
| 6 | Ga0123353_10258210 | 3300010167 | Bacteria | 2694 |
| 7 | Ga0123353_11123629 | 3300010167 | Bacteria | 1040 |
| 8 | Ga0466705_093839 | 3300042612 | Unclassified | 2945 |
| 9 | Ga0466706_099032 | 3300042599 | Bacteria | 1228 |
| 10 | Ga0466707_086183 | 3300042601 | Bacteria | 3792 |
| 11 | Ga0466719_247481 | 3300042606 | Unclassified | 5400 |
| 12 | JGI24705J35276_12227844 | 3300002504 | Bacteria | 3075 |
| 13 | Ga0072941_1407740 | 3300005201 | Bacteria | 4003 |
| 14 | Ga0255572_1003062 | 3300026175 | Bacteria | 13299 |
| 15 | Ga0415639_027539 | 3300038395 | Bacteria | 3067 |
| 16 | Ga0415639_048314 | 3300038395 | Bacteria | 9832 |
| 17 | Ga0466696_020275 | 3300042596 | Bacteria | 9899 |
| 18 | Ga0466696_190465 | 3300042596 | Bacteria | 1978 |
| 19 | Ga0466705_481459 | 3300042612 | Bacteria | 1759 |
| 20 | Ga0466712_191684 | 3300042614 | Bacteria | 10287 |
| 21 | Ga0466712_192521 | 3300042614 | Bacteria | 10507 |
| 22 | Ga0466711_457579 | 3300042615 | Bacteria | 6103 |
| 23 | Ga0466726_262835 | 3300042619 | Bacteria | 2514 |
| 24 | Ga0466729_038370 | 3300042621 | Bacteria | 10126 |
| 25 | Ga0123356_10247961 | 3300010049 | Bacteria | 1857 |
| 26 | Ga0123356_10388319 | 3300010049 | Bacteria | 1530 |
| 27 | Ga0123356_10835988 | 3300010049 | Bacteria | 1092 |
| 28 | Ga0123353_11284856 | 3300010167 | Bacteria | 952 |
| 29 | Ga0123354_10252281 | 3300010882 | Bacteria | 1784 |
| 30 | Ga0123354_10298023 | 3300010882 | Bacteria | 1531 |
| 31 | Ga0123354_10481781 | 3300010882 | Bacteria | 981 |
| 32 | Ga0466697_198943 | 3300042611 | Bacteria | 2215 |
| 33 | Ga0466707_005922 | 3300042601 | Bacteria | 6760 |
| 34 | Ga0466707_067147 | 3300042601 | Bacteria | 9292 |
| 35 | Ga0466714_073983 | 3300042603 | Bacteria | 8972 |
| 36 | Ga0466722_061837 | 3300042609 | Bacteria | 1143 |
| 37 | Ga0466698_473056 | 3300042610 | Bacteria | 1803 |
| 38 | JGI24703J35330_11748677 | 3300002501 | Bacteria | 24621 |
| 39 | Ga0068305_10119423 | 3300005083 | Bacteria | 2509 |
| 40 | Ga0072940_1309702 | 3300005200 | Bacteria | 2366 |
| 41 | Ga0415639_017697 | 3300038395 | Bacteria | 17477 |
| 42 | Ga0415639_079285 | 3300038395 | Bacteria | 2001 |
| 43 | Ga0466694_101450 | 3300042594 | Bacteria | 2101 |
| 44 | Ga0466726_463409 | 3300042619 | Bacteria | 12539 |
| 45 | Ga0466702_187689 | 3300042635 | Bacteria | 2665 |
| 46 | Ga0466702_313381 | 3300042635 | Bacteria | 12028 |
| 47 | Ga0466703_006839 | 3300042636 | Bacteria | 10885 |
| 48 | Ga0466704_474023 | 3300042643 | Bacteria | 4616 |
| 49 | Ga0123357_10057045 | 3300009784 | Bacteria | 5249 |
| 50 | Ga0123356_10141019 | 3300010049 | Bacteria | 2377 |
| 51 | Ga0123354_10000203 | 3300010882 | Bacteria | 51448 |
| 52 | Ga0466714_038189 | 3300042603 | Bacteria | 1030 |
| 53 | Ga0466714_057255 | 3300042603 | Bacteria | 1209 |
| 54 | Ga0466714_136158 | 3300042603 | Bacteria | 1497 |
| 55 | Ga0466719_051377 | 3300042606 | Bacteria | 2055 |
| 56 | IMNBL1DRAFT_c0000716 | 3300000062 | Bacteria | 26465 |
| 57 | JGI24695J34938_10011170 | 3300002450 | Bacteria | 4856 |
| 58 | Ga0415639_002133 | 3300038395 | Bacteria | 56853 |
| 59 | Ga0415639_099561 | 3300038395 | Bacteria | 8965 |
| 60 | Ga0415639_123509 | 3300038395 | Bacteria | 1856 |
| 61 | Ga0466712_062527 | 3300042614 | Bacteria | 2215 |
| 62 | Ga0466712_201837 | 3300042614 | Bacteria | 27185 |
| 63 | Ga0466711_425392 | 3300042615 | Bacteria | 1987 |
| 64 | Ga0466715_023745 | 3300042616 | Bacteria | 3937 |
| 65 | Ga0466726_158468 | 3300042619 | Bacteria | 2806 |
| 66 | Ga0466729_014188 | 3300042621 | Bacteria | 9039 |
| 67 | Ga0466704_022178 | 3300042643 | Bacteria | 1875 |
| 68 | Ga0466704_211659 | 3300042643 | Bacteria | 9880 |
| 69 | Ga0123357_10122349 | 3300009784 | Bacteria | 3273 |
| 70 | Ga0123356_10298862 | 3300010049 | Bacteria | 1714 |
| 71 | Ga0123353_10005366 | 3300010167 | Bacteria | 16798 |
| 72 | Ga0123353_10079974 | 3300010167 | Bacteria | 5257 |
| 73 | Ga0123353_10170881 | 3300010167 | Bacteria | 3451 |
| 74 | Ga0466705_146538 | 3300042612 | Bacteria | 158344 |
| 75 | Ga0466733_029841 | 3300042659 | Bacteria | 2559 |
| 76 | Ga0466700_084092 | 3300042600 | Bacteria | 36011 |
| 77 | Ga0466716_529007 | 3300042605 | Unclassified | 1852 |
| 78 | 2227177474 | 2225789004 | Bacteria | 1504 |
| 79 | IMNBL1DRAFT_c0001794 | 3300000062 | Bacteria | 15697 |
| 80 | IMNBL1DRAFT_c0012076 | 3300000062 | Bacteria | 3976 |
| 81 | JGI24698J34947_10002984 | 3300002449 | Bacteria | 9169 |
| 82 | JGI24698J34947_10094666 | 3300002449 | Unclassified | 1360 |
| 83 | JGI24702J35022_10117220 | 3300002462 | Bacteria | 1468 |
| 84 | Ga0072941_1004239 | 3300005201 | Bacteria | 63520 |
| 85 | Ga0415639_087151 | 3300038395 | Bacteria | 2654 |
| 86 | Ga0415639_122194 | 3300038395 | Bacteria | 3286 |
| 87 | Ga0466690_356718 | 3300042590 | Bacteria | 3563 |
| 88 | Ga0466691_130620 | 3300042593 | Bacteria | 3699 |
| 89 | Ga0466705_511508 | 3300042612 | Bacteria | 4688 |
| 90 | Ga0466726_052979 | 3300042619 | Bacteria | 2406 |
| 91 | Ga0466726_425963 | 3300042619 | Bacteria | 2670 |
| 92 | Ga0466704_596816 | 3300042643 | Bacteria | 34729 |
| 93 | Ga0466727_201680 | 3300042655 | Bacteria | 13883 |
| 94 | Ga0123357_10004537 | 3300009784 | Bacteria | 16335 |
| 95 | Ga0123356_10002748 | 3300010049 | Bacteria | 18699 |
| 96 | Ga0123356_10163095 | 3300010049 | Bacteria | 2229 |
| 97 | Ga0123356_10469999 | 3300010049 | Bacteria | 1409 |
| 98 | Ga0123356_11068995 | 3300010049 | Bacteria | 976 |
| 99 | Ga0123353_10089146 | 3300010167 | Bacteria | 4967 |
| 100 | Ga0123353_10322797 | 3300010167 | Bacteria | 2342 |
| 101 | Ga0123353_10735000 | 3300010167 | Bacteria | 1377 |
| 102 | Ga0123353_10891578 | 3300010167 | Archaea | 1212 |
| 103 | Ga0123354_10284028 | 3300010882 | Bacteria | 1601 |
| 104 | Ga0466705_095969 | 3300042612 | Bacteria | 3906 |
| 105 | Ga0466705_298789 | 3300042612 | Bacteria | 1488 |
| 106 | Ga0466707_358175 | 3300042601 | Archaea | 2455 |
| 107 | Ga0466714_031714 | 3300042603 | Bacteria | 6041 |
| 108 | Ga0466714_087292 | 3300042603 | Bacteria | 5304 |
| 109 | Ga0466714_134673 | 3300042603 | Bacteria | 2000 |
| 110 | Ga0466719_172413 | 3300042606 | Bacteria | 3560 |
| 111 | Ga0466722_136691 | 3300042609 | Bacteria | 5795 |
| 112 | Ga0466722_194309 | 3300042609 | Bacteria | 2283 |
| 113 | Ga0466698_036396 | 3300042610 | Bacteria | 1610 |
| 114 | JGI24698J34947_10002368 | 3300002449 | Bacteria | 10146 |
| 115 | JGI24703J35330_11635563 | 3300002501 | Unclassified | 1517 |
| 116 | Ga0415639_003610 | 3300038395 | Bacteria | 2627 |
| 117 | Ga0415639_122187 | 3300038395 | Bacteria | 3231 |
| 118 | Ga0466705_487246 | 3300042612 | Bacteria | 59518 |
| 119 | Ga0466715_043310 | 3300042616 | Bacteria | 9844 |
| 120 | Ga0466715_215100 | 3300042616 | Bacteria | 21470 |
| 121 | Ga0466726_058169 | 3300042619 | Bacteria | 2088 |
| 122 | Ga0466704_158170 | 3300042643 | Bacteria | 13255 |
| 123 | Ga0123357_10568083 | 3300009784 | Bacteria | 892 |
| 124 | Ga0123353_10002901 | 3300010167 | Bacteria | 21475 |
| 125 | Ga0123353_10007144 | 3300010167 | Bacteria | 15039 |
| 126 | Ga0123353_10023306 | 3300010167 | Bacteria | 9367 |
| 127 | Ga0123353_10184435 | 3300010167 | Bacteria | 3300 |
| 128 | Ga0123353_10367971 | 3300010167 | Unclassified | 2157 |
| 129 | Ga0466706_014877 | 3300042599 | Bacteria | 13889 |
| 130 | Ga0466706_017333 | 3300042599 | Bacteria | 1972 |
| 131 | Ga0466707_118464 | 3300042601 | Bacteria | 1186 |
| 132 | Ga0466698_484736 | 3300042610 | Bacteria | 74014 |
| 133 | Ga0466698_504919 | 3300042610 | Bacteria | 2022 |
| 134 | 2227616264 | 2225789004 | Bacteria | 11982 |
| 135 | IMNBL1DRAFT_c0000016 | 3300000062 | Bacteria | 178436 |
| 136 | JGI24698J34947_10000057 | 3300002449 | Bacteria | 34270 |
| 137 | JGI24702J35022_10000022 | 3300002462 | Bacteria | 61888 |
| 138 | Ga0068305_10185734 | 3300005083 | Bacteria | 1217 |
| 139 | Ga0415639_011635 | 3300038395 | Bacteria | 14813 |
| 140 | Ga0466696_149778 | 3300042596 | Bacteria | 11523 |
| 141 | Ga0466696_180847 | 3300042596 | Bacteria | 13438 |
| 142 | Ga0466711_365805 | 3300042615 | Bacteria | 2466 |
| 143 | Ga0466715_176503 | 3300042616 | Bacteria | 11535 |
| 144 | Ga0466715_559486 | 3300042616 | Bacteria | 45977 |
| 145 | Ga0466723_090577 | 3300042618 | Bacteria | 13138 |
| 146 | Ga0466735_132359 | 3300042624 | Bacteria | 21856 |
| 147 | Ga0466702_428766 | 3300042635 | Bacteria | 2967 |
| 148 | Ga0466703_078719 | 3300042636 | Bacteria | 1667 |
| 149 | Ga0123357_10095856 | 3300009784 | Bacteria | 3844 |
| 150 | Ga0123356_10014561 | 3300010049 | Bacteria | 7559 |
| 151 | Ga0123356_10079432 | 3300010049 | Bacteria | 3099 |
| 152 | Ga0123356_10101484 | 3300010049 | Bacteria | 2761 |
| 153 | Ga0123353_10013853 | 3300010167 | Bacteria | 11581 |
| 154 | Ga0123353_10038601 | 3300010167 | Bacteria | 7507 |
| 155 | Ga0123353_10048131 | 3300010167 | Bacteria | 6787 |
| 156 | Ga0123353_10056648 | 3300010167 | Bacteria | 6275 |
| 157 | Ga0123353_10245191 | 3300010167 | Bacteria | 2780 |
| 158 | Ga0123353_10609635 | 3300010167 | Bacteria | 1557 |
| 159 | Ga0123353_10683090 | 3300010167 | Bacteria | 1445 |
| 160 | Ga0123353_10723529 | 3300010167 | Unclassified | 1391 |
| 161 | Ga0123354_10026145 | 3300010882 | Bacteria | 9205 |
| 162 | Ga0123354_10049015 | 3300010882 | Bacteria | 6411 |
| 163 | Ga0466705_107840 | 3300042612 | Bacteria | 1247 |
| 164 | Ga0466705_364057 | 3300042612 | Bacteria | 12329 |
| 165 | Ga0466733_125612 | 3300042659 | Bacteria | 2540 |
| 166 | Ga0466706_198388 | 3300042599 | Bacteria | 2416 |
| 167 | Ga0466707_057216 | 3300042601 | Archaea | 1637 |
| 168 | Ga0466707_349187 | 3300042601 | Bacteria | 1267 |
| 169 | Ga0466714_003848 | 3300042603 | Bacteria | 22429 |
| 170 | Ga0466722_074775 | 3300042609 | Bacteria | 5001 |
| 171 | 2227607678 | 2225789004 | Bacteria | 2287 |
| 172 | IMNBL1DRAFT_c0000004 | 3300000062 | Bacteria | 271062 |
| 173 | IMNBL1DRAFT_c0004710 | 3300000062 | Bacteria | 8078 |
| 174 | IMNBL1DRAFT_c0034017 | 3300000062 | Bacteria | 1819 |
| 175 | Ga0072940_1091634 | 3300005200 | Bacteria | 6793 |
| 176 | Ga0415639_138269 | 3300038395 | Bacteria | 2350 |
| 177 | Ga0415639_144646 | 3300038395 | Bacteria | 3091 |
| 178 | Ga0466693_331993 | 3300042592 | Bacteria | 3065 |
| 179 | Ga0466705_480748 | 3300042612 | Bacteria | 2568 |
| 180 | Ga0466712_016616 | 3300042614 | Bacteria | 50610 |
| 181 | Ga0466712_223246 | 3300042614 | Bacteria | 13680 |
| 182 | Ga0466715_569107 | 3300042616 | Bacteria | 27351 |
| 183 | Ga0466715_607828 | 3300042616 | Bacteria | 77672 |
| 184 | Ga0466718_083964 | 3300042617 | Bacteria | 26896 |
| 185 | Ga0466702_029641 | 3300042635 | Bacteria | 2544 |
| 186 | Ga0466704_186666 | 3300042643 | Bacteria | 15559 |
| 187 | Ga0466724_33891 | 3300042649 | Bacteria | 4497 |
| 188 | Ga0466727_276655 | 3300042655 | Bacteria | 12524 |
| 189 | Ga0466727_316689 | 3300042655 | Bacteria | 58164 |
| 190 | Ga0123357_10161766 | 3300009784 | Bacteria | 2681 |
| 191 | Ga0123355_10143920 | 3300009826 | Bacteria | 3640 |
| 192 | Ga0123356_10171431 | 3300010049 | Bacteria | 2181 |
| 193 | Ga0123353_10004216 | 3300010167 | Bacteria | 18462 |
| 194 | Ga0123353_10044105 | 3300010167 | Bacteria | 7068 |
| 195 | Ga0123353_10119262 | 3300010167 | Bacteria | 4243 |
| 196 | Ga0123353_10691859 | 3300010167 | Bacteria | 1433 |
| 197 | Ga0123353_11003053 | 3300010167 | Bacteria | 1122 |
| 198 | Ga0466733_040318 | 3300042659 | Bacteria | 3280 |
| 199 | Ga0466707_366052 | 3300042601 | Bacteria | 1051 |
| 200 | Ga0466713_006748 | 3300042602 | Bacteria | 20574 |
| 201 | Ga0466717_256147 | 3300042604 | Bacteria | 5322 |
| 202 | 2227075222 | 2225789003 | Bacteria | 11365 |
| 203 | JGI24698J34947_10000415 | 3300002449 | Bacteria | 19555 |
| 204 | JGI24695J34938_10024028 | 3300002450 | Bacteria | 2930 |
| 205 | JGI24703J35330_11746095 | 3300002501 | Bacteria | 4981 |
| 206 | JGI24705J35276_12211019 | 3300002504 | Bacteria | 1843 |
| 207 | Ga0068305_10059545 | 3300005083 | Bacteria | 14068 |
| 208 | Ga0072940_1316124 | 3300005200 | Bacteria | 2576 |
| 209 | Ga0072940_1361269 | 3300005200 | Bacteria | 1163 |
| 210 | Ga0072941_1007848 | 3300005201 | Bacteria | 14978 |
| 211 | Ga0415639_014674 | 3300038395 | Bacteria | 42449 |
| 212 | Ga0415639_017358 | 3300038395 | Bacteria | 4905 |
| 213 | Ga0466696_347134 | 3300042596 | Bacteria | 1187 |
| 214 | Ga0466705_469869 | 3300042612 | Bacteria | 11516 |
| 215 | Ga0466711_353867 | 3300042615 | Bacteria | 5716 |
| 216 | Ga0466726_318760 | 3300042619 | Bacteria | 1313 |
| 217 | Ga0466702_424841 | 3300042635 | Bacteria | 3182 |
| 218 | Ga0466704_219933 | 3300042643 | Bacteria | 1099 |
| 219 | Ga0466727_275596 | 3300042655 | Bacteria | 2075 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.