Protein Family IF07398

Metagenome Isolate
252 Members
82 Samples
219 Scaffolds
241.36 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_201837|Ga0466712_201837_18629_19483
Length
284 aa
Sequence
VLKNYQYSWYTQSGNLASGPAYIHPEDFPHIITRFNIEEQNYLYGVFMLRIEHLTKTYGDKKAVDDLSLDIADGEICGFIGPNGAGKTTTIKSVCGILGFDSGEIYIGEKSIRREPIECKRRMAYIPDNPDLYDFLSGIKYLNFIADVYGIGVTERQERIRLYADMFELTADLAQPIAAYSHGMKQKLALISAFIHEPEFLVLDEPFVGLDPMASRVVKDLMRKKCDGGGAVFFSTHILEVAEKLCDKVAIIKNGRLVAWGDMDKVRGDGSLEKVFFELEEGKA

πŸ“Š Sample Types

Isolate 13.1%
Metagenome 86.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 33.3%
Unclassified 32.1%
Kalotermitidae 13.6%
Passalidae 3.7%
Blattidae 3.7%
Termopsidae 3.7%
Stratiomyidae 2.5%
Rhinotermitidae 2.5%
Hydrophilidae 1.2%
Dytiscidae 1.2%
Formicidae 1.2%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 3
Bacteria 242
Eukaryota 0
Viruses 0
Unclassified 7

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
2 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
3 2820403592 Unclassified Firmicutes Lab288P4bin93 Isolate Unclassified
4 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
5 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
6 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
7 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
8 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
9 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
10 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
11 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
12 2820406809 Unclassified Firmicutes Lab288P4bin87 Isolate Unclassified
13 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
14 2820476618 Unclassified Firmicutes Lab288P1bin80 Isolate Unclassified
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
20 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
21 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
22 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
23 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2916858470 Heyndrickxia oleronia Isolate Unclassified
26 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
27 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
28 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
29 2820679524 Unclassified Firmicutes Co191P1bin94 Isolate Unclassified
30 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
31 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
32 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
36 2590828840 Clostridium sp. 2 Isolate Termitidae
37 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
38 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
39 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
40 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
41 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
42 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
43 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
44 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
45 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
46 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
47 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
48 2820565217 Unclassified Firmicutes Emb289P3bin51 Isolate Unclassified
49 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
50 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
51 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
52 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
53 8064008355 Heyndrickxia oleronia Isolate Unclassified
54 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
55 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
56 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
57 2593339124 Clostridium sp. 4 Isolate Termitidae
58 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
59 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
60 2820427814 Unclassified Firmicutes Lab288P3bin44 Isolate Unclassified
61 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
62 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
63 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
64 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
65 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
66 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
67 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
68 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
69 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
70 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
71 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
72 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
73 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
74 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
75 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
76 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
77 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
78 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
79 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
80 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
81 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
82 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10583145 3300009784 Bacteria 870
2 Ga0123355_10117979 3300009826 Bacteria 4125
3 Ga0123353_10018186 3300010167 Bacteria 10379
4 Ga0123353_10175688 3300010167 Bacteria 3396
5 Ga0123353_10248712 3300010167 Bacteria 2756
6 Ga0123353_10258210 3300010167 Bacteria 2694
7 Ga0123353_11123629 3300010167 Bacteria 1040
8 Ga0466705_093839 3300042612 Unclassified 2945
9 Ga0466706_099032 3300042599 Bacteria 1228
10 Ga0466707_086183 3300042601 Bacteria 3792
11 Ga0466719_247481 3300042606 Unclassified 5400
12 JGI24705J35276_12227844 3300002504 Bacteria 3075
13 Ga0072941_1407740 3300005201 Bacteria 4003
14 Ga0255572_1003062 3300026175 Bacteria 13299
15 Ga0415639_027539 3300038395 Bacteria 3067
16 Ga0415639_048314 3300038395 Bacteria 9832
17 Ga0466696_020275 3300042596 Bacteria 9899
18 Ga0466696_190465 3300042596 Bacteria 1978
19 Ga0466705_481459 3300042612 Bacteria 1759
20 Ga0466712_191684 3300042614 Bacteria 10287
21 Ga0466712_192521 3300042614 Bacteria 10507
22 Ga0466711_457579 3300042615 Bacteria 6103
23 Ga0466726_262835 3300042619 Bacteria 2514
24 Ga0466729_038370 3300042621 Bacteria 10126
25 Ga0123356_10247961 3300010049 Bacteria 1857
26 Ga0123356_10388319 3300010049 Bacteria 1530
27 Ga0123356_10835988 3300010049 Bacteria 1092
28 Ga0123353_11284856 3300010167 Bacteria 952
29 Ga0123354_10252281 3300010882 Bacteria 1784
30 Ga0123354_10298023 3300010882 Bacteria 1531
31 Ga0123354_10481781 3300010882 Bacteria 981
32 Ga0466697_198943 3300042611 Bacteria 2215
33 Ga0466707_005922 3300042601 Bacteria 6760
34 Ga0466707_067147 3300042601 Bacteria 9292
35 Ga0466714_073983 3300042603 Bacteria 8972
36 Ga0466722_061837 3300042609 Bacteria 1143
37 Ga0466698_473056 3300042610 Bacteria 1803
38 JGI24703J35330_11748677 3300002501 Bacteria 24621
39 Ga0068305_10119423 3300005083 Bacteria 2509
40 Ga0072940_1309702 3300005200 Bacteria 2366
41 Ga0415639_017697 3300038395 Bacteria 17477
42 Ga0415639_079285 3300038395 Bacteria 2001
43 Ga0466694_101450 3300042594 Bacteria 2101
44 Ga0466726_463409 3300042619 Bacteria 12539
45 Ga0466702_187689 3300042635 Bacteria 2665
46 Ga0466702_313381 3300042635 Bacteria 12028
47 Ga0466703_006839 3300042636 Bacteria 10885
48 Ga0466704_474023 3300042643 Bacteria 4616
49 Ga0123357_10057045 3300009784 Bacteria 5249
50 Ga0123356_10141019 3300010049 Bacteria 2377
51 Ga0123354_10000203 3300010882 Bacteria 51448
52 Ga0466714_038189 3300042603 Bacteria 1030
53 Ga0466714_057255 3300042603 Bacteria 1209
54 Ga0466714_136158 3300042603 Bacteria 1497
55 Ga0466719_051377 3300042606 Bacteria 2055
56 IMNBL1DRAFT_c0000716 3300000062 Bacteria 26465
57 JGI24695J34938_10011170 3300002450 Bacteria 4856
58 Ga0415639_002133 3300038395 Bacteria 56853
59 Ga0415639_099561 3300038395 Bacteria 8965
60 Ga0415639_123509 3300038395 Bacteria 1856
61 Ga0466712_062527 3300042614 Bacteria 2215
62 Ga0466712_201837 3300042614 Bacteria 27185
63 Ga0466711_425392 3300042615 Bacteria 1987
64 Ga0466715_023745 3300042616 Bacteria 3937
65 Ga0466726_158468 3300042619 Bacteria 2806
66 Ga0466729_014188 3300042621 Bacteria 9039
67 Ga0466704_022178 3300042643 Bacteria 1875
68 Ga0466704_211659 3300042643 Bacteria 9880
69 Ga0123357_10122349 3300009784 Bacteria 3273
70 Ga0123356_10298862 3300010049 Bacteria 1714
71 Ga0123353_10005366 3300010167 Bacteria 16798
72 Ga0123353_10079974 3300010167 Bacteria 5257
73 Ga0123353_10170881 3300010167 Bacteria 3451
74 Ga0466705_146538 3300042612 Bacteria 158344
75 Ga0466733_029841 3300042659 Bacteria 2559
76 Ga0466700_084092 3300042600 Bacteria 36011
77 Ga0466716_529007 3300042605 Unclassified 1852
78 2227177474 2225789004 Bacteria 1504
79 IMNBL1DRAFT_c0001794 3300000062 Bacteria 15697
80 IMNBL1DRAFT_c0012076 3300000062 Bacteria 3976
81 JGI24698J34947_10002984 3300002449 Bacteria 9169
82 JGI24698J34947_10094666 3300002449 Unclassified 1360
83 JGI24702J35022_10117220 3300002462 Bacteria 1468
84 Ga0072941_1004239 3300005201 Bacteria 63520
85 Ga0415639_087151 3300038395 Bacteria 2654
86 Ga0415639_122194 3300038395 Bacteria 3286
87 Ga0466690_356718 3300042590 Bacteria 3563
88 Ga0466691_130620 3300042593 Bacteria 3699
89 Ga0466705_511508 3300042612 Bacteria 4688
90 Ga0466726_052979 3300042619 Bacteria 2406
91 Ga0466726_425963 3300042619 Bacteria 2670
92 Ga0466704_596816 3300042643 Bacteria 34729
93 Ga0466727_201680 3300042655 Bacteria 13883
94 Ga0123357_10004537 3300009784 Bacteria 16335
95 Ga0123356_10002748 3300010049 Bacteria 18699
96 Ga0123356_10163095 3300010049 Bacteria 2229
97 Ga0123356_10469999 3300010049 Bacteria 1409
98 Ga0123356_11068995 3300010049 Bacteria 976
99 Ga0123353_10089146 3300010167 Bacteria 4967
100 Ga0123353_10322797 3300010167 Bacteria 2342
101 Ga0123353_10735000 3300010167 Bacteria 1377
102 Ga0123353_10891578 3300010167 Archaea 1212
103 Ga0123354_10284028 3300010882 Bacteria 1601
104 Ga0466705_095969 3300042612 Bacteria 3906
105 Ga0466705_298789 3300042612 Bacteria 1488
106 Ga0466707_358175 3300042601 Archaea 2455
107 Ga0466714_031714 3300042603 Bacteria 6041
108 Ga0466714_087292 3300042603 Bacteria 5304
109 Ga0466714_134673 3300042603 Bacteria 2000
110 Ga0466719_172413 3300042606 Bacteria 3560
111 Ga0466722_136691 3300042609 Bacteria 5795
112 Ga0466722_194309 3300042609 Bacteria 2283
113 Ga0466698_036396 3300042610 Bacteria 1610
114 JGI24698J34947_10002368 3300002449 Bacteria 10146
115 JGI24703J35330_11635563 3300002501 Unclassified 1517
116 Ga0415639_003610 3300038395 Bacteria 2627
117 Ga0415639_122187 3300038395 Bacteria 3231
118 Ga0466705_487246 3300042612 Bacteria 59518
119 Ga0466715_043310 3300042616 Bacteria 9844
120 Ga0466715_215100 3300042616 Bacteria 21470
121 Ga0466726_058169 3300042619 Bacteria 2088
122 Ga0466704_158170 3300042643 Bacteria 13255
123 Ga0123357_10568083 3300009784 Bacteria 892
124 Ga0123353_10002901 3300010167 Bacteria 21475
125 Ga0123353_10007144 3300010167 Bacteria 15039
126 Ga0123353_10023306 3300010167 Bacteria 9367
127 Ga0123353_10184435 3300010167 Bacteria 3300
128 Ga0123353_10367971 3300010167 Unclassified 2157
129 Ga0466706_014877 3300042599 Bacteria 13889
130 Ga0466706_017333 3300042599 Bacteria 1972
131 Ga0466707_118464 3300042601 Bacteria 1186
132 Ga0466698_484736 3300042610 Bacteria 74014
133 Ga0466698_504919 3300042610 Bacteria 2022
134 2227616264 2225789004 Bacteria 11982
135 IMNBL1DRAFT_c0000016 3300000062 Bacteria 178436
136 JGI24698J34947_10000057 3300002449 Bacteria 34270
137 JGI24702J35022_10000022 3300002462 Bacteria 61888
138 Ga0068305_10185734 3300005083 Bacteria 1217
139 Ga0415639_011635 3300038395 Bacteria 14813
140 Ga0466696_149778 3300042596 Bacteria 11523
141 Ga0466696_180847 3300042596 Bacteria 13438
142 Ga0466711_365805 3300042615 Bacteria 2466
143 Ga0466715_176503 3300042616 Bacteria 11535
144 Ga0466715_559486 3300042616 Bacteria 45977
145 Ga0466723_090577 3300042618 Bacteria 13138
146 Ga0466735_132359 3300042624 Bacteria 21856
147 Ga0466702_428766 3300042635 Bacteria 2967
148 Ga0466703_078719 3300042636 Bacteria 1667
149 Ga0123357_10095856 3300009784 Bacteria 3844
150 Ga0123356_10014561 3300010049 Bacteria 7559
151 Ga0123356_10079432 3300010049 Bacteria 3099
152 Ga0123356_10101484 3300010049 Bacteria 2761
153 Ga0123353_10013853 3300010167 Bacteria 11581
154 Ga0123353_10038601 3300010167 Bacteria 7507
155 Ga0123353_10048131 3300010167 Bacteria 6787
156 Ga0123353_10056648 3300010167 Bacteria 6275
157 Ga0123353_10245191 3300010167 Bacteria 2780
158 Ga0123353_10609635 3300010167 Bacteria 1557
159 Ga0123353_10683090 3300010167 Bacteria 1445
160 Ga0123353_10723529 3300010167 Unclassified 1391
161 Ga0123354_10026145 3300010882 Bacteria 9205
162 Ga0123354_10049015 3300010882 Bacteria 6411
163 Ga0466705_107840 3300042612 Bacteria 1247
164 Ga0466705_364057 3300042612 Bacteria 12329
165 Ga0466733_125612 3300042659 Bacteria 2540
166 Ga0466706_198388 3300042599 Bacteria 2416
167 Ga0466707_057216 3300042601 Archaea 1637
168 Ga0466707_349187 3300042601 Bacteria 1267
169 Ga0466714_003848 3300042603 Bacteria 22429
170 Ga0466722_074775 3300042609 Bacteria 5001
171 2227607678 2225789004 Bacteria 2287
172 IMNBL1DRAFT_c0000004 3300000062 Bacteria 271062
173 IMNBL1DRAFT_c0004710 3300000062 Bacteria 8078
174 IMNBL1DRAFT_c0034017 3300000062 Bacteria 1819
175 Ga0072940_1091634 3300005200 Bacteria 6793
176 Ga0415639_138269 3300038395 Bacteria 2350
177 Ga0415639_144646 3300038395 Bacteria 3091
178 Ga0466693_331993 3300042592 Bacteria 3065
179 Ga0466705_480748 3300042612 Bacteria 2568
180 Ga0466712_016616 3300042614 Bacteria 50610
181 Ga0466712_223246 3300042614 Bacteria 13680
182 Ga0466715_569107 3300042616 Bacteria 27351
183 Ga0466715_607828 3300042616 Bacteria 77672
184 Ga0466718_083964 3300042617 Bacteria 26896
185 Ga0466702_029641 3300042635 Bacteria 2544
186 Ga0466704_186666 3300042643 Bacteria 15559
187 Ga0466724_33891 3300042649 Bacteria 4497
188 Ga0466727_276655 3300042655 Bacteria 12524
189 Ga0466727_316689 3300042655 Bacteria 58164
190 Ga0123357_10161766 3300009784 Bacteria 2681
191 Ga0123355_10143920 3300009826 Bacteria 3640
192 Ga0123356_10171431 3300010049 Bacteria 2181
193 Ga0123353_10004216 3300010167 Bacteria 18462
194 Ga0123353_10044105 3300010167 Bacteria 7068
195 Ga0123353_10119262 3300010167 Bacteria 4243
196 Ga0123353_10691859 3300010167 Bacteria 1433
197 Ga0123353_11003053 3300010167 Bacteria 1122
198 Ga0466733_040318 3300042659 Bacteria 3280
199 Ga0466707_366052 3300042601 Bacteria 1051
200 Ga0466713_006748 3300042602 Bacteria 20574
201 Ga0466717_256147 3300042604 Bacteria 5322
202 2227075222 2225789003 Bacteria 11365
203 JGI24698J34947_10000415 3300002449 Bacteria 19555
204 JGI24695J34938_10024028 3300002450 Bacteria 2930
205 JGI24703J35330_11746095 3300002501 Bacteria 4981
206 JGI24705J35276_12211019 3300002504 Bacteria 1843
207 Ga0068305_10059545 3300005083 Bacteria 14068
208 Ga0072940_1316124 3300005200 Bacteria 2576
209 Ga0072940_1361269 3300005200 Bacteria 1163
210 Ga0072941_1007848 3300005201 Bacteria 14978
211 Ga0415639_014674 3300038395 Bacteria 42449
212 Ga0415639_017358 3300038395 Bacteria 4905
213 Ga0466696_347134 3300042596 Bacteria 1187
214 Ga0466705_469869 3300042612 Bacteria 11516
215 Ga0466711_353867 3300042615 Bacteria 5716
216 Ga0466726_318760 3300042619 Bacteria 1313
217 Ga0466702_424841 3300042635 Bacteria 3182
218 Ga0466704_219933 3300042643 Bacteria 1099
219 Ga0466727_275596 3300042655 Bacteria 2075

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 65 207 0.94
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 163 240 0.76

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.