Protein Family IF07354

Metagenome Isolate
192 Members
59 Samples
177 Scaffolds
308.91 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_061247|Ga0466712_061247_58_1143
Length
349 aa
Sequence
MSEQREIRAAYVDTLVALAEKNKDIVVLEADLMNCTNTGAFKKAYPDRFFNCGIAEANMVSIAAGLSTLGKIPFAASFGCFAARRVFDQFFLSANYARLNVKLTGTDPGVTSAFNGGTHMPFEELALMRVVPGLTVIEPSDPVACAAFVRLMAEEYGCHYLRIPRKPVPVLYPENETFKFGKAKILKEGKDVCFVALGSLMVNQSLKAAETLAASGISAGVLDVLTLKPIDRNAILEQAGKVRAIISVENAQIAGGLGGATAEILAEDGCRCKFARIDYLVDRFGLDVGSIVKKAQALLGSGKTRNQTENIPQLNRERISTTSCVLFAFLISASASVRTNVMIRSKICR

📊 Sample Types

Isolate 7.8%
Metagenome 92.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.1%
Unclassified 26.3%
Kalotermitidae 21.1%
Rhinotermitidae 7.0%
Termopsidae 3.5%

🌳 Taxonomy

Archaea 0
Bacteria 158
Eukaryota 0
Viruses 0
Unclassified 34

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
6 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
7 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 2228664001 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA Metagenome Termitidae
10 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
11 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
12 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
13 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
14 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
31 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
32 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
33 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
34 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
35 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
36 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
37 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
38 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
39 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
40 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
41 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
42 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
43 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
44 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
47 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
48 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
49 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
50 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
51 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
55 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
56 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
57 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
58 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
59 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_151857 3300042656 Bacteria 6577
2 Ga0466690_414082 3300042590 Bacteria 1605
3 Ga0466692_150410 3300042591 Bacteria 17592
4 Ga0466691_078438 3300042593 Bacteria 2983
5 Ga0466694_005840 3300042594 Bacteria 106514
6 Ga0466694_248840 3300042594 Bacteria 1680
7 Ga0466694_320115 3300042594 Bacteria 2840
8 Ga0123356_10000045 3300010049 Bacteria 131000
9 Ga0466705_451082 3300042612 Bacteria 13208
10 Ga0466712_082917 3300042614 Bacteria 5019
11 Ga0466712_118079 3300042614 Bacteria 15494
12 Ga0466718_022709 3300042617 Unclassified 6573
13 Ga0466723_120716 3300042618 Bacteria 4340
14 Ga0466726_331491 3300042619 Bacteria 6955
15 Ga0466709_148132 3300042648 Bacteria 2274
16 JGI24698J34947_10042393 3300002449 Unclassified 2339
17 JGI24698J34947_10093083 3300002449 Unclassified 1377
18 JGI24695J34938_10004943 3300002450 Bacteria 8509
19 JGI24695J34938_10011864 3300002450 Bacteria 4659
20 JGI24695J34938_10023332 3300002450 Bacteria 2985
21 Ga0074263_109907 3300005485 Unclassified 4590
22 Ga0415639_025562 3300038395 Bacteria 26729
23 Ga0456237_0002835 3300041968 Bacteria 2809
24 Ga0466694_124871 3300042594 Bacteria 2619
25 Ga0466694_365904 3300042594 Bacteria 24111
26 Ga0123356_10001332 3300010049 Bacteria 27284
27 Ga0123356_10004208 3300010049 Unclassified 14895
28 Ga0466712_175017 3300042614 Bacteria 45826
29 Ga0466718_010742 3300042617 Bacteria 1618
30 Ga0466718_086504 3300042617 Bacteria 1278
31 Ga0466729_231211 3300042621 Bacteria 1962
32 Ga0466704_329108 3300042643 Bacteria 12411
33 Ga0466708_184862 3300042652 Bacteria 2533
34 AustNasuHG_c1013674 3300000089 Bacteria 2777
35 JGI24698J34947_10025583 3300002449 Unclassified 3141
36 JGI24698J34947_10107425 3300002449 Unclassified 1239
37 JGI24695J34938_10002753 3300002450 Bacteria 12923
38 JGI24695J34938_10002773 3300002450 Bacteria 12848
39 JGI24695J34938_10005990 3300002450 Bacteria 7428
40 JGI24695J34938_10008821 3300002450 Unclassified 5704
41 Ga0072941_1116542 3300005201 Unclassified 3445
42 Ga0466707_116757 3300042601 Bacteria 3035
43 Ga0466707_359428 3300042601 Bacteria 2289
44 Ga0466720_076209 3300042607 Bacteria 10623
45 Ga0466720_121626 3300042607 Bacteria 5962
46 Ga0466722_135333 3300042609 Bacteria 1434
47 Ga0415639_008220 3300038395 Unclassified 5766
48 Ga0466692_049752 3300042591 Unclassified 7155
49 Ga0466694_042205 3300042594 Bacteria 30345
50 Ga0466699_213107 3300042597 Bacteria 2105
51 Ga0123355_10331965 3300009826 Bacteria 2036
52 Ga0123356_10779808 3300010049 Bacteria 1127
53 Ga0123356_10870102 3300010049 Unclassified 1072
54 Ga0466712_023799 3300042614 Bacteria 49566
55 Ga0466712_035404 3300042614 Bacteria 6040
56 Ga0466712_071329 3300042614 Bacteria 17104
57 Ga0466718_027153 3300042617 Unclassified 1309
58 JGI24698J34947_10005079 3300002449 Bacteria 7206
59 Ga0466700_084421 3300042600 Bacteria 3583
60 Ga0466707_263539 3300042601 Bacteria 1294
61 Ga0466720_017554 3300042607 Bacteria 14352
62 Ga0466721_280584 3300042608 Bacteria 1906
63 Ga0466721_378271 3300042608 Bacteria 2491
64 Ga0466698_060166 3300042610 Bacteria 1491
65 Ga0466698_455514 3300042610 Bacteria 1068
66 Ga0466732_063074 3300042656 Bacteria 8125
67 Ga0466693_021526 3300042592 Bacteria 40073
68 Ga0466691_023232 3300042593 Bacteria 12208
69 Ga0466694_221922 3300042594 Bacteria 39680
70 Ga0466699_183487 3300042597 Bacteria 2983
71 Ga0123356_10001070 3300010049 Bacteria 30301
72 Ga0123356_10001803 3300010049 Bacteria 23328
73 Ga0123356_10011781 3300010049 Bacteria 8511
74 Ga0123356_10044743 3300010049 Bacteria 4121
75 Ga0123356_10271339 3300010049 Unclassified 1786
76 Ga0466712_166561 3300042614 Bacteria 8162
77 Ga0466715_104100 3300042616 Bacteria 6047
78 Ga0466718_000310 3300042617 Bacteria 5893
79 Ga0466718_031286 3300042617 Unclassified 1998
80 Ga0466718_034274 3300042617 Bacteria 2911
81 Ga0466718_089693 3300042617 Bacteria 3495
82 Ga0466723_254467 3300042618 Bacteria 2704
83 Ga0466723_261830 3300042618 Bacteria 34957
84 Ga0466731_012920 3300042622 Bacteria 154202
85 Ga0466731_025925 3300042622 Bacteria 3533
86 Ga0466735_073137 3300042624 Bacteria 4073
87 Ga0466702_238937 3300042635 Unclassified 9149
88 Ga0466703_093680 3300042636 Bacteria 4923
89 AustNasuHG_c1038139 3300000089 Unclassified 1214
90 JGI24698J34947_10041178 3300002449 Unclassified 2380
91 JGI24695J34938_10001339 3300002450 Bacteria 21290
92 Ga0072941_1001705 3300005201 Bacteria 12498
93 Ga0074263_104871 3300005485 Bacteria 2546
94 Ga0466707_353659 3300042601 Bacteria 1883
95 Ga0466719_378975 3300042606 Bacteria 1828
96 Ga0466720_215498 3300042607 Bacteria 9532
97 Ga0466722_079156 3300042609 Bacteria 1854
98 Ga0466722_146661 3300042609 Bacteria 20647
99 Ga0466690_073940 3300042590 Bacteria 1296
100 Ga0466690_375956 3300042590 Bacteria 9740
101 Ga0466690_384976 3300042590 Bacteria 1752
102 Ga0466693_074486 3300042592 Bacteria 1144
103 Ga0466694_390963 3300042594 Bacteria 2996
104 Ga0123356_10003914 3300010049 Bacteria 15502
105 Ga0123356_10059233 3300010049 Bacteria 3572
106 Ga0123356_10074406 3300010049 Bacteria 3196
107 Ga0123356_10295374 3300010049 Unclassified 1723
108 Ga0123353_10015581 3300010167 Bacteria 11058
109 Ga0466712_032421 3300042614 Unclassified 3212
110 Ga0466712_044054 3300042614 Unclassified 1568
111 Ga0466712_265289 3300042614 Bacteria 8551
112 Ga0466718_044352 3300042617 Unclassified 2237
113 Ga0466718_054556 3300042617 Bacteria 4840
114 Ga0466723_016670 3300042618 Unclassified 2996
115 AustNasuHG_c1014922 3300000089 Bacteria 2631
116 JGI24698J34947_10048439 3300002449 Unclassified 2152
117 JGI24695J34938_10000138 3300002450 Bacteria 66191
118 JGI24695J34938_10000445 3300002450 Bacteria 39971
119 JGI24695J34938_10000515 3300002450 Bacteria 37684
120 Ga0466720_018106 3300042607 Bacteria 11027
121 Ga0466722_267773 3300042609 Bacteria 5300
122 Ga0264413_102755 3300024493 Bacteria 22484
123 Ga0466692_045777 3300042591 Bacteria 14960
124 Ga0466692_101621 3300042591 Unclassified 1554
125 Ga0466694_223825 3300042594 Bacteria 36366
126 Ga0466696_283124 3300042596 Bacteria 12572
127 Ga0466699_172385 3300042597 Bacteria 3480
128 Ga0123355_10608422 3300009826 Unclassified 1294
129 Ga0123356_10000910 3300010049 Bacteria 32750
130 Ga0466712_266224 3300042614 Bacteria 24891
131 Ga0466718_086252 3300042617 Bacteria 1980
132 Ga0466718_121749 3300042617 Bacteria 2577
133 Ga0466723_160471 3300042618 Bacteria 9416
134 Ga0466702_422355 3300042635 Bacteria 3102
135 AustNasuHG_c1016696 3300000089 Bacteria 2451
136 AustNasuHG_c1024700 3300000089 Bacteria 1899
137 AustNasuHG_c1040547 3300000089 Bacteria 1136
138 JGI24695J34938_10000125 3300002450 Bacteria 68505
139 JGI24695J34938_10009776 3300002450 Bacteria 5309
140 JGI24695J34938_10025571 3300002450 Unclassified 2820
141 JGI24697J35500_11254552 3300002507 Unclassified 2668
142 JGI24697J35500_11270570 3300002507 Bacteria 4254
143 Ga0264413_116331 3300024493 Bacteria 10299
144 Ga0466694_165019 3300042594 Unclassified 2429
145 Ga0466694_304707 3300042594 Bacteria 2892
146 Ga0123356_10023907 3300010049 Bacteria 5750
147 Ga0123356_10060724 3300010049 Bacteria 3528
148 Ga0123356_10103619 3300010049 Bacteria 2734
149 Ga0466712_061247 3300042614 Unclassified 1216
150 Ga0466718_015759 3300042617 Unclassified 1962
151 Ga0466731_078965 3300042622 Bacteria 2887
152 Ga0466731_214532 3300042622 Bacteria 6432
153 Ga0466731_312869 3300042622 Bacteria 11649
154 JGI24698J34947_10001631 3300002449 Bacteria 11940
155 JGI24698J34947_10035642 3300002449 Bacteria 2596
156 JGI24695J34938_10032377 3300002450 Bacteria 2416
157 Ga0072940_1114522 3300005200 Bacteria 2020
158 Ga0466720_023630 3300042607 Bacteria 1685
159 Ga0466720_147828 3300042607 Bacteria 8332
160 Ga0466722_032604 3300042609 Bacteria 1609
161 Ga0466691_012038 3300042593 Bacteria 8990
162 Ga0466694_200569 3300042594 Bacteria 12898
163 Ga0466695_295531 3300042595 Bacteria 145433
164 Ga0466699_083036 3300042597 Bacteria 30507
165 Ga0466699_313126 3300042597 Bacteria 1810
166 Ga0123356_10002892 3300010049 Bacteria 18191
167 Ga0466712_245662 3300042614 Bacteria 18426
168 Ga0466712_285131 3300042614 Bacteria 5312
169 Ga0466718_107243 3300042617 Unclassified 1074
170 Ga0466731_231250 3300042622 Unclassified 1179
171 Ga0466709_104383 3300042648 Bacteria 21621
172 2230929984 2228664001 Unclassified 6005
173 AustNasuHG_c1007244 3300000089 Bacteria 3947
174 JGI24698J34947_10000265 3300002449 Bacteria 22370
175 JGI24695J34938_10000965 3300002450 Bacteria 26225
176 JGI24695J34938_10014324 3300002450 Bacteria 4114
177 Ga0466716_190559 3300042605 Bacteria 8749

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02779 Transket_pyr Transketolase, pyrimidine binding domain 6 167 0.95
PF02780 Transketolase_C Transketolase, C-terminal domain 181 270 0.93
PF17147 PFOR_II Pyruvate:ferredoxin oxidoreductase core domain II 191 265 0.89

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.