Protein Family IF07346
Metagenome
Metatranscriptome
Isolate
120
Members
47
Samples
118
Scaffolds
74.94
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_048668|Ga0466712_048668_515_778
- Length
- 87 aa
- Sequence
- MRNSFKNLTFAELKAKRDELSRKYMDFRFQMIIGHVDNPLQKRLFRRQIARLNTLIHGHEMAQQEQAKTSAANAPATPTSLATASKA
Sample Types
Isolate
1.7%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
1.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.7%
Kalotermitidae
31.1%
Unclassified
8.9%
Termopsidae
6.7%
Rhinotermitidae
4.4%
Hodotermitidae
2.2%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 24 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 25 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 30 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 43 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 46 | 3300021232 | Termite gut microbial communities from nest from French Guiana - FG16_14_4 mRNA SA | Metatranscriptome | |
| 47 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_071870 | 3300042656 | Bacteria | 1967 |
| 2 | Ga0223676_1012190 | 3300021232 | Bacteria | 733 |
| 3 | Ga0466713_128250 | 3300042602 | Bacteria | 3709 |
| 4 | Ga0466716_437922 | 3300042605 | Bacteria | 19281 |
| 5 | Ga0466719_351165 | 3300042606 | Bacteria | 12805 |
| 6 | Ga0466735_214009 | 3300042624 | Bacteria | 1722 |
| 7 | Ga0466703_104430 | 3300042636 | Bacteria | 21196 |
| 8 | Ga0466715_222811 | 3300042616 | Bacteria | 24815 |
| 9 | Ga0466715_369095 | 3300042616 | Bacteria | 13389 |
| 10 | Ga0466726_314555 | 3300042619 | Bacteria | 1806 |
| 11 | Ga0466705_023623 | 3300042612 | Bacteria | 5713 |
| 12 | Ga0466732_172207 | 3300042656 | Bacteria | 1764 |
| 13 | Ga0466691_015001 | 3300042593 | Bacteria | 24199 |
| 14 | Ga0466699_319799 | 3300042597 | Bacteria | 3167 |
| 15 | Ga0466701_062392 | 3300042598 | Bacteria | 1054 |
| 16 | Ga0466719_411304 | 3300042606 | Bacteria | 2664 |
| 17 | Ga0466704_214222 | 3300042643 | Bacteria | 11711 |
| 18 | Ga0466708_115426 | 3300042652 | Bacteria | 1369 |
| 19 | Ga0466711_005006 | 3300042615 | Bacteria | 1053 |
| 20 | Ga0466715_108335 | 3300042616 | Bacteria | 1122 |
| 21 | Ga0466715_150441 | 3300042616 | Bacteria | 29649 |
| 22 | Ga0466723_240188 | 3300042618 | Bacteria | 3393 |
| 23 | Ga0466732_076026 | 3300042656 | Bacteria | 3499 |
| 24 | Ga0466690_424141 | 3300042590 | Bacteria | 11663 |
| 25 | Ga0466692_086049 | 3300042591 | Bacteria | 21718 |
| 26 | Ga0466696_182607 | 3300042596 | Bacteria | 2597 |
| 27 | Ga0466699_002667 | 3300042597 | Bacteria | 1040 |
| 28 | Ga0466701_078389 | 3300042598 | Bacteria | 1098 |
| 29 | Ga0466703_422882 | 3300042636 | Bacteria | 4885 |
| 30 | Ga0466704_258052 | 3300042643 | Bacteria | 7209 |
| 31 | Ga0123353_10568456 | 3300010167 | Bacteria | 1630 |
| 32 | Ga0123353_10959353 | 3300010167 | Bacteria | 1155 |
| 33 | Ga0466699_058674 | 3300042597 | Bacteria | 3421 |
| 34 | Ga0466699_397710 | 3300042597 | Bacteria | 1021 |
| 35 | JGI24698J34947_10010104 | 3300002449 | Bacteria | 5175 |
| 36 | JGI24698J34947_10316972 | 3300002449 | Bacteria | 556 |
| 37 | Ga0466735_062655 | 3300042624 | Bacteria | 4422 |
| 38 | Ga0466715_338738 | 3300042616 | Bacteria | 2269 |
| 39 | Ga0466723_195578 | 3300042618 | Bacteria | 19421 |
| 40 | Ga0466723_212610 | 3300042618 | Bacteria | 31402 |
| 41 | Ga0123356_11251934 | 3300010049 | Bacteria | 907 |
| 42 | Ga0123356_12225061 | 3300010049 | Bacteria | 685 |
| 43 | Ga0123353_10003570 | 3300010167 | Bacteria | 19691 |
| 44 | Ga0123353_10044741 | 3300010167 | Bacteria | 7020 |
| 45 | Ga0123353_10297530 | 3300010167 | Unclassified | 2466 |
| 46 | Ga0123354_10543091 | 3300010882 | Bacteria | 881 |
| 47 | Ga0466692_199021 | 3300042591 | Bacteria | 2878 |
| 48 | Ga0466696_272484 | 3300042596 | Bacteria | 24883 |
| 49 | Ga0072940_1027100 | 3300005200 | Bacteria | 1750 |
| 50 | Ga0123357_10001013 | 3300009784 | Bacteria | 28794 |
| 51 | Ga0466706_042072 | 3300042599 | Bacteria | 1525 |
| 52 | Ga0466709_309524 | 3300042648 | Bacteria | 19652 |
| 53 | Ga0466708_011474 | 3300042652 | Bacteria | 16565 |
| 54 | Ga0466712_007206 | 3300042614 | Bacteria | 3040 |
| 55 | Ga0466715_362118 | 3300042616 | Bacteria | 1131 |
| 56 | Ga0466728_295245 | 3300042620 | Bacteria | 6010 |
| 57 | Ga0123356_13879837 | 3300010049 | Bacteria | 516 |
| 58 | Ga0123353_10534450 | 3300010167 | Bacteria | 1696 |
| 59 | Ga0123353_12295474 | 3300010167 | Bacteria | 649 |
| 60 | Ga0123353_12761740 | 3300010167 | Bacteria | 576 |
| 61 | Ga0466690_157401 | 3300042590 | Bacteria | 11752 |
| 62 | Ga0466693_275075 | 3300042592 | Bacteria | 1100 |
| 63 | Ga0466694_223134 | 3300042594 | Bacteria | 1338 |
| 64 | Ga0466696_334108 | 3300042596 | Bacteria | 35042 |
| 65 | JGI24698J34947_10277776 | 3300002449 | Bacteria | 613 |
| 66 | Ga0068302_10348751 | 3300005071 | Bacteria | 591 |
| 67 | Ga0466701_073103 | 3300042598 | Bacteria | 1285 |
| 68 | Ga0466717_261217 | 3300042604 | Bacteria | 1701 |
| 69 | Ga0466716_393053 | 3300042605 | Bacteria | 12262 |
| 70 | Ga0466731_100517 | 3300042622 | Bacteria | 1004 |
| 71 | Ga0466703_143105 | 3300042636 | Bacteria | 17971 |
| 72 | Ga0466704_074659 | 3300042643 | Bacteria | 15694 |
| 73 | Ga0466708_056187 | 3300042652 | Bacteria | 2552 |
| 74 | Ga0466715_517604 | 3300042616 | Bacteria | 2751 |
| 75 | Ga0466726_285056 | 3300042619 | Bacteria | 1358 |
| 76 | Ga0123353_11661429 | 3300010167 | Bacteria | 802 |
| 77 | Ga0264413_112829 | 3300024493 | Bacteria | 1711 |
| 78 | Ga0466691_109493 | 3300042593 | Bacteria | 23172 |
| 79 | Ga0466694_163660 | 3300042594 | Bacteria | 2917 |
| 80 | Ga0466696_283737 | 3300042596 | Bacteria | 2598 |
| 81 | Ga0466699_152809 | 3300042597 | Bacteria | 1391 |
| 82 | JGI24698J34947_10008346 | 3300002449 | Bacteria | 5683 |
| 83 | JGI24698J34947_10062454 | 3300002449 | Bacteria | 1829 |
| 84 | JGI24698J34947_10152552 | 3300002449 | Bacteria | 957 |
| 85 | Ga0466719_176803 | 3300042606 | Bacteria | 1151 |
| 86 | Ga0466719_223627 | 3300042606 | Bacteria | 5153 |
| 87 | Ga0466720_144831 | 3300042607 | Bacteria | 1174 |
| 88 | Ga0466703_044908 | 3300042636 | Bacteria | 22014 |
| 89 | Ga0466704_304489 | 3300042643 | Bacteria | 9247 |
| 90 | Ga0466712_048668 | 3300042614 | Bacteria | 1539 |
| 91 | Ga0466712_138499 | 3300042614 | Bacteria | 1260 |
| 92 | Ga0466711_353540 | 3300042615 | Bacteria | 1973 |
| 93 | Ga0466715_086384 | 3300042616 | Bacteria | 11934 |
| 94 | Ga0466718_150982 | 3300042617 | Bacteria | 1236 |
| 95 | Ga0466723_029844 | 3300042618 | Bacteria | 15406 |
| 96 | Ga0123356_10694955 | 3300010049 | Bacteria | 1186 |
| 97 | Ga0123356_11805498 | 3300010049 | Bacteria | 760 |
| 98 | Ga0123353_10347133 | 3300010167 | Bacteria | 2238 |
| 99 | Ga0123353_10367682 | 3300010167 | Bacteria | 2158 |
| 100 | Ga0123353_11014754 | 3300010167 | Bacteria | 1113 |
| 101 | Ga0123353_12835985 | 3300010167 | Bacteria | 567 |
| 102 | Ga0123354_10305866 | 3300010882 | Bacteria | 1495 |
| 103 | Ga0255786_1004416 | 3300022815 | Bacteria | 734 |
| 104 | Ga0456237_0001275 | 3300041968 | Bacteria | 3988 |
| 105 | JGI24698J34947_10009359 | 3300002449 | Bacteria | 5379 |
| 106 | JGI24702J35022_10045795 | 3300002462 | Bacteria | 2330 |
| 107 | JGI24705J35276_11942982 | 3300002504 | Bacteria | 787 |
| 108 | JGI24696J40584_12909912 | 3300002834 | Bacteria | 1247 |
| 109 | Ga0466707_215128 | 3300042601 | Bacteria | 2272 |
| 110 | Ga0466717_233059 | 3300042604 | Bacteria | 1647 |
| 111 | Ga0466719_019759 | 3300042606 | Bacteria | 2771 |
| 112 | Ga0466698_052560 | 3300042610 | Bacteria | 1802 |
| 113 | Ga0466712_035190 | 3300042614 | Bacteria | 2966 |
| 114 | Ga0466723_074053 | 3300042618 | Bacteria | 35080 |
| 115 | Ga0123356_10794247 | 3300010049 | Bacteria | 1117 |
| 116 | Ga0123353_10146935 | 3300010167 | Bacteria | 3768 |
| 117 | Ga0123353_10282626 | 3300010167 | Bacteria | 2547 |
| 118 | Ga0123353_12347606 | 3300010167 | Bacteria | 640 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00831 | Ribosomal_L29 | Ribosomal L29 protein | 5 | 57 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.