Protein Family IF07314
Metagenome
Isolate
328
Members
98
Samples
294
Scaffolds
196.33
Avg Length
Representative Sequence
- ID
- 3300042613|Ga0466710_317787|Ga0466710_317787_5359_6075
- Length
- 238 aa
- Sequence
- LLGKASIYNRQSQNIAKYNKVQQGKYRRSQISIKNKTLIMSSEELELEIGGSQNKRVKISSYMREILPLLGENPDREGLIKTPERVAKAMQYLTKGYWQDPEEILRSALFREDYRQMVIVKDIDFFSLCEHHMLPLFGKAHIAYIPDGYITGLSKIARVVDVFARRLQVQERLTLQIKECIQKTLNPMGVMVVIEAQHMCMQMRGVEKQNSVTTTSDFTGVFKEQKTREEFISLIKGR
Sample Types
Isolate
10.4%
Metagenome
89.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.1%
Blattidae
20.8%
Kalotermitidae
14.6%
Unclassified
13.5%
Rhinotermitidae
5.2%
Termopsidae
4.2%
Passalidae
3.1%
Drosophilidae
3.1%
Culicidae
2.1%
Hydrophilidae
2.1%
Hodotermitidae
1.0%
Armadillidiidae
1.0%
Tenebrionidae
1.0%
Taxonomy
Archaea
0
Bacteria
308
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 3 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 4 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 5 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 13 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 17 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 23 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 24 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 25 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 26 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 31 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 32 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 33 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 34 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 40 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 44 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 45 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 48 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 49 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 50 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 51 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 52 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 53 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 54 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 55 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 56 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 57 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 58 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 59 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 60 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 66 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 67 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 68 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 69 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 70 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 71 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 72 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 73 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 74 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 75 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 76 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 77 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 78 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 79 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 80 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 81 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 82 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 83 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 84 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 85 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 86 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 87 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 88 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 89 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 90 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 91 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 92 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 93 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 94 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 95 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 96 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 97 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 98 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_037690 | 3300042612 | Bacteria | 3797 |
| 2 | Ga0466656_293141 | 3300042550 | Bacteria | 1164 |
| 3 | Ga0466690_144810 | 3300042590 | Bacteria | 2835 |
| 4 | Ga0466690_213399 | 3300042590 | Bacteria | 31259 |
| 5 | Ga0466691_048123 | 3300042593 | Bacteria | 9676 |
| 6 | Ga0466696_267649 | 3300042596 | Bacteria | 36863 |
| 7 | Ga0466701_044349 | 3300042598 | Bacteria | 7090 |
| 8 | Ga0466706_081386 | 3300042599 | Bacteria | 4301 |
| 9 | Ga0466713_061207 | 3300042602 | Bacteria | 22897 |
| 10 | Ga0466715_257449 | 3300042616 | Bacteria | 2850 |
| 11 | Ga0466715_340501 | 3300042616 | Bacteria | 21718 |
| 12 | Ga0466723_016266 | 3300042618 | Bacteria | 13385 |
| 13 | Ga0466728_137456 | 3300042620 | Bacteria | 5177 |
| 14 | Ga0466728_338284 | 3300042620 | Bacteria | 92891 |
| 15 | Ga0466729_041915 | 3300042621 | Bacteria | 2669 |
| 16 | Ga0466729_111977 | 3300042621 | Bacteria | 7425 |
| 17 | Ga0123356_10188207 | 3300010049 | Bacteria | 2092 |
| 18 | Ga0123353_10018623 | 3300010167 | Bacteria | 10274 |
| 19 | Ga0123354_10000043 | 3300010882 | Bacteria | 94179 |
| 20 | Ga0123354_10016871 | 3300010882 | Bacteria | 11439 |
| 21 | Ga0466735_067242 | 3300042624 | Bacteria | 15289 |
| 22 | Ga0466704_516982 | 3300042643 | Bacteria | 2402 |
| 23 | Ga0466724_10854 | 3300042649 | Unclassified | 11934 |
| 24 | Ga0466725_088552 | 3300042654 | Bacteria | 1413 |
| 25 | Ga0466727_262691 | 3300042655 | Bacteria | 1139 |
| 26 | JGI24702J35022_10020411 | 3300002462 | Unclassified | 3597 |
| 27 | JGI24705J35276_12232771 | 3300002504 | Unclassified | 4497 |
| 28 | Ga0068305_10007593 | 3300005083 | Bacteria | 80483 |
| 29 | Ga0068305_10449019 | 3300005083 | Unclassified | 1544 |
| 30 | Ga0466697_211668 | 3300042611 | Bacteria | 1478 |
| 31 | Ga0466705_202501 | 3300042612 | Bacteria | 5118 |
| 32 | Ga0466705_255991 | 3300042612 | Bacteria | 7130 |
| 33 | Ga0466732_419485 | 3300042656 | Bacteria | 2671 |
| 34 | Ga0466733_093475 | 3300042659 | Bacteria | 2822 |
| 35 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 36 | Ga0160445_104519 | 3300012847 | Bacteria | 2529 |
| 37 | Ga0466690_152563 | 3300042590 | Bacteria | 28032 |
| 38 | Ga0466692_003697 | 3300042591 | Bacteria | 64811 |
| 39 | Ga0466693_072799 | 3300042592 | Bacteria | 2674 |
| 40 | Ga0466693_107769 | 3300042592 | Bacteria | 1023 |
| 41 | Ga0466691_089325 | 3300042593 | Bacteria | 13196 |
| 42 | Ga0466696_010174 | 3300042596 | Bacteria | 34499 |
| 43 | Ga0466696_333547 | 3300042596 | Bacteria | 12618 |
| 44 | Ga0466706_064637 | 3300042599 | Bacteria | 7331 |
| 45 | Ga0466700_473520 | 3300042600 | Bacteria | 1076 |
| 46 | Ga0466707_129612 | 3300042601 | Bacteria | 4417 |
| 47 | Ga0466713_018109 | 3300042602 | Bacteria | 29610 |
| 48 | Ga0466713_055725 | 3300042602 | Bacteria | 54491 |
| 49 | Ga0466713_068486 | 3300042602 | Bacteria | 8561 |
| 50 | Ga0466713_095206 | 3300042602 | Bacteria | 7897 |
| 51 | Ga0466713_125564 | 3300042602 | Bacteria | 27296 |
| 52 | Ga0466713_148297 | 3300042602 | Bacteria | 51780 |
| 53 | Ga0466714_105424 | 3300042603 | Unclassified | 4049 |
| 54 | Ga0466719_424623 | 3300042606 | Bacteria | 4892 |
| 55 | Ga0466722_128906 | 3300042609 | Bacteria | 4272 |
| 56 | Ga0466722_147538 | 3300042609 | Bacteria | 8140 |
| 57 | Ga0466715_568822 | 3300042616 | Bacteria | 17364 |
| 58 | Ga0466723_224491 | 3300042618 | Bacteria | 10542 |
| 59 | Ga0466726_013143 | 3300042619 | Bacteria | 12145 |
| 60 | Ga0466726_396104 | 3300042619 | Bacteria | 1003 |
| 61 | Ga0466728_294577 | 3300042620 | Bacteria | 10111 |
| 62 | Ga0123357_10060706 | 3300009784 | Bacteria | 5070 |
| 63 | Ga0123357_10149997 | 3300009784 | Bacteria | 2833 |
| 64 | Ga0123353_11121457 | 3300010167 | Bacteria | 1042 |
| 65 | Ga0123354_10187185 | 3300010882 | Bacteria | 2336 |
| 66 | Ga0466729_295951 | 3300042621 | Bacteria | 5398 |
| 67 | Ga0466735_100297 | 3300042624 | Bacteria | 1671 |
| 68 | Ga0466704_480099 | 3300042643 | Bacteria | 39129 |
| 69 | Ga0466709_304135 | 3300042648 | Bacteria | 18714 |
| 70 | Ga0466708_142981 | 3300042652 | Bacteria | 6042 |
| 71 | Ga0466708_211595 | 3300042652 | Unclassified | 4572 |
| 72 | Ga0466708_258663 | 3300042652 | Bacteria | 34932 |
| 73 | Ga0466725_176145 | 3300042654 | Bacteria | 20828 |
| 74 | 2227144693 | 2225789004 | Bacteria | 8668 |
| 75 | JGI24702J35022_10010057 | 3300002462 | Bacteria | 5300 |
| 76 | JGI24702J35022_10026141 | 3300002462 | Bacteria | 3146 |
| 77 | JGI24705J35276_12229061 | 3300002504 | Bacteria | 3309 |
| 78 | Ga0068305_10015278 | 3300005083 | Bacteria | 26404 |
| 79 | Ga0068305_10530710 | 3300005083 | Bacteria | 3416 |
| 80 | Ga0104048_1000658 | 3300007143 | Bacteria | 16188 |
| 81 | Ga0123357_10002567 | 3300009784 | Bacteria | 20362 |
| 82 | Ga0466697_066144 | 3300042611 | Bacteria | 115209 |
| 83 | Ga0466705_365918 | 3300042612 | Bacteria | 18522 |
| 84 | Ga0466690_061194 | 3300042590 | Bacteria | 18754 |
| 85 | Ga0466690_205348 | 3300042590 | Bacteria | 6348 |
| 86 | Ga0466701_059766 | 3300042598 | Bacteria | 23149 |
| 87 | Ga0466706_142021 | 3300042599 | Bacteria | 39871 |
| 88 | Ga0466706_245597 | 3300042599 | Bacteria | 1782 |
| 89 | Ga0466706_253000 | 3300042599 | Bacteria | 8725 |
| 90 | Ga0466722_093729 | 3300042609 | Bacteria | 3006 |
| 91 | Ga0123357_10041881 | 3300009784 | Bacteria | 6228 |
| 92 | Ga0123356_10216567 | 3300010049 | Bacteria | 1968 |
| 93 | Ga0123354_10238823 | 3300010882 | Bacteria | 1876 |
| 94 | Ga0466735_196180 | 3300042624 | Bacteria | 4635 |
| 95 | Ga0466735_211955 | 3300042624 | Bacteria | 2269 |
| 96 | Ga0466703_193480 | 3300042636 | Bacteria | 20932 |
| 97 | Ga0466704_031330 | 3300042643 | Bacteria | 12348 |
| 98 | Ga0466704_113299 | 3300042643 | Bacteria | 17267 |
| 99 | Ga0466709_124130 | 3300042648 | Bacteria | 272718 |
| 100 | Ga0466724_19684 | 3300042649 | Bacteria | 3054 |
| 101 | Ga0466727_248174 | 3300042655 | Bacteria | 8343 |
| 102 | JGI24705J35276_12119645 | 3300002504 | Bacteria | 1068 |
| 103 | Ga0123357_10002744 | 3300009784 | Bacteria | 19847 |
| 104 | Ga0466697_084889 | 3300042611 | Bacteria | 2479 |
| 105 | Ga0466733_222052 | 3300042659 | Bacteria | 81292 |
| 106 | Ga0160434_100306 | 3300012850 | Bacteria | 16980 |
| 107 | Ga0466657_045905 | 3300042582 | Unclassified | 3248 |
| 108 | Ga0466690_126245 | 3300042590 | Bacteria | 4928 |
| 109 | Ga0466693_186699 | 3300042592 | Bacteria | 1188 |
| 110 | Ga0466696_017950 | 3300042596 | Bacteria | 25498 |
| 111 | Ga0466706_025174 | 3300042599 | Bacteria | 118676 |
| 112 | Ga0466706_115528 | 3300042599 | Bacteria | 26872 |
| 113 | Ga0466706_192891 | 3300042599 | Bacteria | 26478 |
| 114 | Ga0466700_362753 | 3300042600 | Bacteria | 6652 |
| 115 | Ga0466707_034403 | 3300042601 | Bacteria | 7106 |
| 116 | Ga0466707_279667 | 3300042601 | Bacteria | 1213 |
| 117 | Ga0466707_379100 | 3300042601 | Bacteria | 27378 |
| 118 | Ga0466716_432821 | 3300042605 | Bacteria | 15010 |
| 119 | Ga0466722_053445 | 3300042609 | Bacteria | 38463 |
| 120 | Ga0466722_099911 | 3300042609 | Bacteria | 2418 |
| 121 | Ga0466710_317787 | 3300042613 | Bacteria | 9476 |
| 122 | Ga0466715_202920 | 3300042616 | Bacteria | 11351 |
| 123 | Ga0466726_001282 | 3300042619 | Bacteria | 2793 |
| 124 | Ga0123356_10293299 | 3300010049 | Bacteria | 1728 |
| 125 | Ga0123354_10135625 | 3300010882 | Bacteria | 3080 |
| 126 | Ga0466735_022550 | 3300042624 | Bacteria | 3257 |
| 127 | Ga0466735_034846 | 3300042624 | Bacteria | 3610 |
| 128 | Ga0466735_114683 | 3300042624 | Bacteria | 1775 |
| 129 | Ga0466703_010568 | 3300042636 | Bacteria | 5834 |
| 130 | Ga0466704_051808 | 3300042643 | Bacteria | 24293 |
| 131 | Ga0466709_179537 | 3300042648 | Bacteria | 24533 |
| 132 | Ga0466708_019018 | 3300042652 | Unclassified | 4465 |
| 133 | Ga0466727_265906 | 3300042655 | Bacteria | 1880 |
| 134 | 2227247442 | 2225789004 | Bacteria | 32559 |
| 135 | JGI24702J35022_10154729 | 3300002462 | Bacteria | 1288 |
| 136 | JGI24702J35022_10197176 | 3300002462 | Unclassified | 1151 |
| 137 | JGI24705J35276_12234696 | 3300002504 | Bacteria | 5750 |
| 138 | JGI24699J35502_11134001 | 3300002509 | Bacteria | 23818 |
| 139 | JGI24696J40584_12847073 | 3300002834 | Bacteria | 970 |
| 140 | Ga0466705_098789 | 3300042612 | Bacteria | 12464 |
| 141 | Ga0160441_100003 | 3300012825 | Bacteria | 759726 |
| 142 | Ga0466657_237558 | 3300042582 | Bacteria | 26291 |
| 143 | Ga0466690_095134 | 3300042590 | Unclassified | 6914 |
| 144 | Ga0466690_142446 | 3300042590 | Bacteria | 5363 |
| 145 | Ga0466690_420451 | 3300042590 | Bacteria | 55352 |
| 146 | Ga0466696_045091 | 3300042596 | Bacteria | 15483 |
| 147 | Ga0466706_103812 | 3300042599 | Bacteria | 57157 |
| 148 | Ga0466706_226283 | 3300042599 | Bacteria | 1640 |
| 149 | Ga0466700_056544 | 3300042600 | Bacteria | 2028 |
| 150 | Ga0466700_267965 | 3300042600 | Bacteria | 20065 |
| 151 | Ga0466707_055506 | 3300042601 | Bacteria | 1148 |
| 152 | Ga0466707_140740 | 3300042601 | Bacteria | 10682 |
| 153 | Ga0466713_070720 | 3300042602 | Bacteria | 20442 |
| 154 | Ga0466713_119907 | 3300042602 | Bacteria | 11759 |
| 155 | Ga0466717_084835 | 3300042604 | Bacteria | 1013 |
| 156 | Ga0466716_049504 | 3300042605 | Bacteria | 14546 |
| 157 | Ga0466710_325186 | 3300042613 | Bacteria | 2234 |
| 158 | Ga0466711_068474 | 3300042615 | Bacteria | 35660 |
| 159 | Ga0123357_10048978 | 3300009784 | Bacteria | 5723 |
| 160 | Ga0123353_10000105 | 3300010167 | Bacteria | 97649 |
| 161 | Ga0123353_10230522 | 3300010167 | Bacteria | 2888 |
| 162 | Ga0123354_10048395 | 3300010882 | Bacteria | 6466 |
| 163 | Ga0466731_112113 | 3300042622 | Bacteria | 1135 |
| 164 | Ga0466734_085860 | 3300042623 | Bacteria | 2113 |
| 165 | Ga0466703_145957 | 3300042636 | Bacteria | 26993 |
| 166 | Ga0466703_183555 | 3300042636 | Bacteria | 1224 |
| 167 | Ga0466704_084948 | 3300042643 | Bacteria | 7669 |
| 168 | Ga0466704_363032 | 3300042643 | Bacteria | 24824 |
| 169 | Ga0466704_549478 | 3300042643 | Unclassified | 3707 |
| 170 | Ga0466725_121813 | 3300042654 | Bacteria | 2623 |
| 171 | 2227467965 | 2225789004 | Bacteria | 5042 |
| 172 | 2227607979 | 2225789004 | Bacteria | 2285 |
| 173 | IMNBL1DRAFT_c0000802 | 3300000062 | Bacteria | 24738 |
| 174 | IMNBL1DRAFT_c0037103 | 3300000062 | Bacteria | 1693 |
| 175 | JGI24699J35502_11134205 | 3300002509 | Bacteria | 56453 |
| 176 | JGI24696J40584_12897714 | 3300002834 | Bacteria | 1166 |
| 177 | Ga0072941_1236442 | 3300005201 | Unclassified | 1544 |
| 178 | Ga0123357_10002874 | 3300009784 | Bacteria | 19418 |
| 179 | Ga0466705_105279 | 3300042612 | Bacteria | 2112 |
| 180 | Ga0466656_361290 | 3300042550 | Bacteria | 14064 |
| 181 | Ga0466692_121438 | 3300042591 | Bacteria | 29354 |
| 182 | Ga0466694_015924 | 3300042594 | Bacteria | 1544 |
| 183 | Ga0466701_027235 | 3300042598 | Bacteria | 12397 |
| 184 | Ga0466701_029840 | 3300042598 | Bacteria | 102818 |
| 185 | Ga0466701_030840 | 3300042598 | Bacteria | 2197 |
| 186 | Ga0466706_144964 | 3300042599 | Bacteria | 38907 |
| 187 | Ga0466706_211053 | 3300042599 | Bacteria | 122086 |
| 188 | Ga0466706_218220 | 3300042599 | Bacteria | 2055 |
| 189 | Ga0466714_023561 | 3300042603 | Bacteria | 53847 |
| 190 | Ga0466716_062214 | 3300042605 | Bacteria | 2982 |
| 191 | Ga0466716_375033 | 3300042605 | Bacteria | 6282 |
| 192 | Ga0466716_532389 | 3300042605 | Bacteria | 2175 |
| 193 | Ga0466719_333138 | 3300042606 | Bacteria | 18795 |
| 194 | Ga0466722_066081 | 3300042609 | Bacteria | 17837 |
| 195 | Ga0466710_050324 | 3300042613 | Unclassified | 5370 |
| 196 | Ga0466711_200864 | 3300042615 | Bacteria | 1442 |
| 197 | Ga0466711_512761 | 3300042615 | Bacteria | 2040 |
| 198 | Ga0466723_313673 | 3300042618 | Bacteria | 69196 |
| 199 | Ga0466728_249816 | 3300042620 | Unclassified | 1801 |
| 200 | Ga0123357_10319210 | 3300009784 | Bacteria | 1537 |
| 201 | Ga0123356_10046855 | 3300010049 | Bacteria | 4022 |
| 202 | Ga0123356_10546285 | 3300010049 | Bacteria | 1319 |
| 203 | Ga0123356_10574790 | 3300010049 | Unclassified | 1290 |
| 204 | Ga0123353_10796166 | 3300010167 | Bacteria | 1306 |
| 205 | Ga0123354_10068495 | 3300010882 | Bacteria | 5159 |
| 206 | Ga0123354_10169416 | 3300010882 | Bacteria | 2550 |
| 207 | Ga0123354_10189378 | 3300010882 | Bacteria | 2311 |
| 208 | Ga0466735_019353 | 3300042624 | Bacteria | 1136 |
| 209 | Ga0466735_097294 | 3300042624 | Bacteria | 2058 |
| 210 | Ga0466735_183321 | 3300042624 | Bacteria | 2794 |
| 211 | Ga0466735_195545 | 3300042624 | Bacteria | 3688 |
| 212 | Ga0466703_164429 | 3300042636 | Bacteria | 1650 |
| 213 | Ga0466704_156772 | 3300042643 | Bacteria | 23282 |
| 214 | Ga0466727_065685 | 3300042655 | Bacteria | 11179 |
| 215 | JGI24695J34938_10127394 | 3300002450 | Bacteria | 1037 |
| 216 | JGI24702J35022_10169521 | 3300002462 | Bacteria | 1234 |
| 217 | JGI24705J35276_12238593 | 3300002504 | Bacteria | 28172 |
| 218 | JGI24699J35502_11133963 | 3300002509 | Bacteria | 21757 |
| 219 | Ga0068305_10014853 | 3300005083 | Bacteria | 20899 |
| 220 | Ga0466705_006744 | 3300042612 | Bacteria | 55663 |
| 221 | Ga0466705_111900 | 3300042612 | Bacteria | 5766 |
| 222 | Ga0160472_101029 | 3300012839 | Bacteria | 9891 |
| 223 | Ga0466690_005627 | 3300042590 | Bacteria | 17343 |
| 224 | Ga0466690_059913 | 3300042590 | Bacteria | 43148 |
| 225 | Ga0466690_233988 | 3300042590 | Bacteria | 5204 |
| 226 | Ga0466692_013335 | 3300042591 | Bacteria | 18802 |
| 227 | Ga0466691_036725 | 3300042593 | Bacteria | 15375 |
| 228 | Ga0466691_145588 | 3300042593 | Bacteria | 11189 |
| 229 | Ga0466691_159492 | 3300042593 | Bacteria | 1159 |
| 230 | Ga0466696_135758 | 3300042596 | Bacteria | 2770 |
| 231 | Ga0466706_042133 | 3300042599 | Bacteria | 7741 |
| 232 | Ga0466706_143096 | 3300042599 | Bacteria | 1243 |
| 233 | Ga0466713_017478 | 3300042602 | Bacteria | 15565 |
| 234 | Ga0466713_040700 | 3300042602 | Bacteria | 6757 |
| 235 | Ga0466713_087024 | 3300042602 | Bacteria | 24872 |
| 236 | Ga0466713_144411 | 3300042602 | Bacteria | 37878 |
| 237 | Ga0466716_475160 | 3300042605 | Bacteria | 5284 |
| 238 | Ga0466719_074194 | 3300042606 | Bacteria | 5559 |
| 239 | Ga0466719_358087 | 3300042606 | Bacteria | 8131 |
| 240 | Ga0466722_010000 | 3300042609 | Bacteria | 11404 |
| 241 | Ga0466710_260428 | 3300042613 | Bacteria | 1201 |
| 242 | Ga0466711_316710 | 3300042615 | Bacteria | 1047 |
| 243 | Ga0466715_131570 | 3300042616 | Bacteria | 22650 |
| 244 | Ga0466726_093756 | 3300042619 | Bacteria | 7111 |
| 245 | Ga0466726_331901 | 3300042619 | Bacteria | 1906 |
| 246 | Ga0466728_174203 | 3300042620 | Bacteria | 15013 |
| 247 | Ga0123353_10004692 | 3300010167 | Unclassified | 17689 |
| 248 | Ga0123354_10000098 | 3300010882 | Bacteria | 64634 |
| 249 | Ga0466734_007095 | 3300042623 | Bacteria | 1490 |
| 250 | Ga0466735_029729 | 3300042624 | Bacteria | 4190 |
| 251 | Ga0466735_195911 | 3300042624 | Bacteria | 3966 |
| 252 | Ga0466704_176919 | 3300042643 | Unclassified | 5288 |
| 253 | Ga0466708_214588 | 3300042652 | Bacteria | 11404 |
| 254 | 2227118055 | 2225789004 | Bacteria | 1713 |
| 255 | JGI24702J35022_10187027 | 3300002462 | Bacteria | 1180 |
| 256 | JGI24699J35502_11134141 | 3300002509 | Bacteria | 36920 |
| 257 | Ga0068305_10092582 | 3300005083 | Bacteria | 3933 |
| 258 | Ga0104050_1003897 | 3300007153 | Unclassified | 7205 |
| 259 | Ga0466733_056376 | 3300042659 | Bacteria | 9903 |
| 260 | Ga0466733_124752 | 3300042659 | Bacteria | 1034 |
| 261 | Ga0415639_126815 | 3300038395 | Bacteria | 3559 |
| 262 | Ga0466693_313325 | 3300042592 | Bacteria | 1899 |
| 263 | Ga0466696_360004 | 3300042596 | Bacteria | 7539 |
| 264 | Ga0466706_053989 | 3300042599 | Bacteria | 17416 |
| 265 | Ga0466706_119498 | 3300042599 | Bacteria | 23651 |
| 266 | Ga0466706_268953 | 3300042599 | Bacteria | 4294 |
| 267 | Ga0466707_067452 | 3300042601 | Bacteria | 54096 |
| 268 | Ga0466707_070837 | 3300042601 | Bacteria | 19880 |
| 269 | Ga0466713_013305 | 3300042602 | Bacteria | 1570 |
| 270 | Ga0466713_095103 | 3300042602 | Bacteria | 13295 |
| 271 | Ga0466722_083782 | 3300042609 | Bacteria | 4792 |
| 272 | Ga0466722_152250 | 3300042609 | Bacteria | 8360 |
| 273 | Ga0466715_301649 | 3300042616 | Bacteria | 1124 |
| 274 | Ga0466715_373317 | 3300042616 | Bacteria | 12645 |
| 275 | Ga0466715_499492 | 3300042616 | Bacteria | 21561 |
| 276 | Ga0466723_348833 | 3300042618 | Bacteria | 2616 |
| 277 | Ga0123357_10006137 | 3300009784 | Bacteria | 14565 |
| 278 | Ga0123357_10127720 | 3300009784 | Bacteria | 3178 |
| 279 | Ga0466731_234586 | 3300042622 | Bacteria | 3103 |
| 280 | Ga0466735_068022 | 3300042624 | Bacteria | 4638 |
| 281 | Ga0466735_133551 | 3300042624 | Bacteria | 2307 |
| 282 | Ga0466735_171934 | 3300042624 | Unclassified | 1238 |
| 283 | Ga0466730_103184 | 3300042625 | Bacteria | 430539 |
| 284 | Ga0466703_251310 | 3300042636 | Bacteria | 38401 |
| 285 | Ga0466709_140267 | 3300042648 | Bacteria | 28990 |
| 286 | Ga0466708_403369 | 3300042652 | Bacteria | 8363 |
| 287 | IMNBGM34_c004402 | 3300000036 | Bacteria | 1909 |
| 288 | IMNBL1DRAFT_c0002254 | 3300000062 | Bacteria | 13572 |
| 289 | JGI24702J35022_10024744 | 3300002462 | Bacteria | 3241 |
| 290 | JGI24705J35276_11930975 | 3300002504 | Unclassified | 776 |
| 291 | JGI24705J35276_12211840 | 3300002504 | Bacteria | 1868 |
| 292 | JGI24696J40584_12711676 | 3300002834 | Bacteria | 749 |
| 293 | Ga0068302_10014902 | 3300005071 | Bacteria | 5696 |
| 294 | Ga0104045_1006311 | 3300007085 | Bacteria | 4697 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01227 | GTP_cyclohydroI | GTP cyclohydrolase I | 60 | 235 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.