Protein Family IF07255

Metagenome Metatranscriptome Isolate
170 Members
119 Samples
112 Scaffolds
390.6 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_505461|Ga0466705_505461_4153_5532
Length
459 aa
Sequence
MSRYTARPAAPLFPFQEKAFFAAVLYRSKSAGMGIAFYTIGGSVPVISEKTAGALFRHFTKSCRFEGGIRGMCMSHRDAVIVAYGRSAIAKASKKGFLRDNSPVEYGSEVLRGVLARIPQCKPESIGDIVIGCAKPEGVQGMNIGRIIAQRAQLPDSVPGKTVNRFCASGLEAIAIGANEIMSGQAEVLAAGGVESMTAIPMGGGAEYRNLWLESNTHVYMSMGLTAENVAEIYGVTREDMERMAVESNRKAGRAQDDGLFEKEIIPVTGTNEAGEPFSFRLDQGVRRTTTMETLAGLKPSFKEDGRVTAATASQVSDGAAFVVMMSADKAAELNVRPIARFVAYAVAGVPADQMGLGPIRAIPQVMARSGLTIADMDVIELNEAFAAQAIPCIQALGLDPEKVNPRGGALALGHPLGATGGILTCKALSYLQDTGGKYALIAMCIGGGMGAAGIIQAI

📊 Sample Types

Isolate 34.1%
Metagenome 64.7%
MAG 0.0%
Metatranscriptome 1.2%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 16.2%
Unclassified 13.5%
Kalotermitidae 9.0%
Culicidae 6.3%
Tenebrionidae 6.3%
Elmidae 5.4%
Armadillidiidae 5.4%
Pyralidae 5.4%
Ixodidae 4.5%
Drosophilidae 3.6%
Scarabaeidae 3.6%
Rhinotermitidae 2.7%
Passalidae 1.8%
Bombycidae 1.8%
Argasidae 1.8%
Formicidae 1.8%
Portunidae 0.9%
Coreidae 0.9%
Ocypodidae 0.9%
Nephropidae 0.9%
Crambidae 0.9%
Alydidae 0.9%
Calliphoridae 0.9%
Noctuidae 0.9%
Eresidae 0.9%
Curculionidae 0.9%
Euphausiidae 0.9%
Termopsidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 149
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
2 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
3 2871564055 Francisella tularensis holarctica FT9C-G7 Isolate Ixodidae
4 2874203443 Francisella tularensis holarctica FT8C-4F Isolate Ixodidae
5 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
6 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
7 2969145278 Bacillus cereus 29 Isolate Portunidae
8 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
9 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
10 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
11 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
12 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
13 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
14 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
15 8064008355 Heyndrickxia oleronia Isolate Unclassified
16 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
17 2864909992 Bacillus velezensis S00166 Isolate Elmidae
18 2874209778 Francisella tularensis holarctica FT16C-B1 Isolate Ixodidae
19 2506210010 Francisella tularensis tularensis FSC041 Isolate
20 2506210015 Francisella tularensis holarctica FSC185 Isolate
21 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
22 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
23 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
24 637000113 Francisella tularensis tularensis FSC 198 Isolate
25 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
26 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
29 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
30 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
31 2871595141 Francisella tularensis 503 Isolate Ixodidae
32 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
33 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
34 2788500057 Francisella-like endosymbiont F-Om Isolate Argasidae
35 2978778678 Bacillus cereus 25 Isolate Ocypodidae
36 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
37 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
38 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
39 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
40 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
41 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
42 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
43 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
44 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
47 2864801025 Bacillus aerius S00042 Isolate Elmidae
48 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
49 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
50 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
51 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
52 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
53 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
54 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
55 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
56 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
57 2820951912 Unclassified Acidobacteria Emb289P4bin26 Isolate Unclassified
58 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
59 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
60 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
61 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
62 2791354885 Francisella endosymbiont of Ornithodoros moubata FLE-Om Isolate Argasidae
63 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
64 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
65 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
66 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
67 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
68 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
69 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
70 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
71 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
72 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
73 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
74 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
75 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
76 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
77 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
78 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
79 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
80 2864895409 Bacillus aerius S00152 Isolate Elmidae
81 2916858470 Heyndrickxia oleronia Isolate Unclassified
82 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
83 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
84 2791354884 Francisella endosymbiont of Amblyomma maculatum FLE-Am Isolate Ixodidae
85 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
86 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
87 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
88 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
89 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
90 8022725327 Bacillus sp. SN10 Isolate Eresidae
91 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
92 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
93 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
94 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
95 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
96 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
97 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
98 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
99 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
100 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
101 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
102 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
103 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
104 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
105 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
106 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
107 2537562000 Bacillus cereus HD73 Isolate Pyralidae
108 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
109 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
110 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
111 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
112 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
113 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
114 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
115 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
116 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
117 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
118 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
119 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_195957 3300042612 Bacteria 3263
2 Ga0562379_0047 3300056790 Bacteria 538703
3 Ga0123353_10075994 3300010167 Bacteria 5397
4 Ga0466710_081347 3300042613 Bacteria 8616
5 Ga0466711_513774 3300042615 Bacteria 4046
6 Ga0160445_100194 3300012847 Bacteria 46960
7 Ga0160457_1001820 3300012858 Unclassified 5242
8 Ga0223674_1015973 3300021235 Bacteria 1472
9 Ga0466657_150388 3300042582 Bacteria 3463
10 Ga0466696_301346 3300042596 Bacteria 1514
11 Ga0466704_044932 3300042643 Bacteria 41096
12 Ga0063521_1000134 3300003973 Unclassified 55239
13 Ga0104019_1190027 3300007150 Bacteria 2950
14 Ga0103267_1000029 3300007190 Bacteria 51888
15 Ga0466705_183888 3300042612 Bacteria 2397
16 Ga0530661_000603 3300056564 Bacteria 24809
17 Ga0123355_10013573 3300009826 Unclassified 12689
18 Ga0123353_10096962 3300010167 Bacteria 4752
19 Ga0466705_399879 3300042612 Unclassified 6812
20 Ga0160453_100645 3300012814 Bacteria 22109
21 Ga0160467_100200 3300012829 Bacteria 77791
22 Ga0466692_021563 3300042591 Bacteria 4601
23 Ga0466703_189371 3300042636 Bacteria 13987
24 2227330784 2225789004 Bacteria 28580
25 IMNBL1DRAFT_c0002968 3300000062 Bacteria 11270
26 Ga0562379_0722 3300056790 Bacteria 55658
27 Ga0562378_0086 3300056814 Bacteria 259059
28 Ga0123355_10002033 3300009826 Bacteria 28590
29 Ga0160454_100948 3300012798 Bacteria 5239
30 Ga0466715_368943 3300042616 Bacteria 2781
31 Ga0160469_100015 3300012824 Bacteria 373407
32 Ga0160435_1003187 3300012857 Unclassified 3911
33 Ga0466691_110958 3300042593 Bacteria 1917
34 Ga0466696_310832 3300042596 Bacteria 8722
35 Ga0466734_005160 3300042623 Bacteria 17019
36 Ga0466708_216513 3300042652 Bacteria 29706
37 Ga0466725_394629 3300042654 Bacteria 1498
38 Ga0466714_074721 3300042603 Bacteria 12135
39 Ga0466719_349244 3300042606 Bacteria 9906
40 Ga0466722_146381 3300042609 Bacteria 11216
41 2212037346 2209111004 Bacteria 27738
42 Ga0466705_328741 3300042612 Bacteria 2125
43 Ga0466705_368709 3300042612 Unclassified 2478
44 Ga0562376_0127 3300056857 Unclassified 169220
45 Ga0123357_10092066 3300009784 Unclassified 3945
46 Ga0123354_10003410 3300010882 Bacteria 21911
47 Ga0123354_10027319 3300010882 Bacteria 8992
48 Ga0466705_505461 3300042612 Bacteria 8713
49 Ga0466715_079621 3300042616 Bacteria 17914
50 Ga0466715_309330 3300042616 Bacteria 5953
51 Ga0160467_100524 3300012829 Bacteria 35881
52 Ga0160460_100013 3300012845 Bacteria 460073
53 Ga0466693_418660 3300042592 Bacteria 6766
54 Ga0466734_021549 3300042623 Bacteria 2709
55 Ga0466713_088843 3300042602 Bacteria 126256
56 Ga0466717_141392 3300042604 Bacteria 6085
57 IMNBL1DRAFT_c0001550 3300000062 Unclassified 17156
58 Ga0466705_106787 3300042612 Bacteria 6891
59 Ga0123355_10020773 3300009826 Bacteria 10496
60 Ga0123356_10093122 3300010049 Bacteria 2875
61 Ga0466705_515135 3300042612 Bacteria 7522
62 Ga0466710_347771 3300042613 Unclassified 1449
63 Ga0466715_316170 3300042616 Bacteria 4238
64 Ga0466726_012845 3300042619 Bacteria 4710
65 Ga0160468_100091 3300012819 Unclassified 107525
66 Ga0160448_104873 3300012854 Unclassified 3630
67 Ga0466730_017026 3300042625 Unclassified 3789
68 Ga0466704_043947 3300042643 Bacteria 5149
69 Ga0466704_099742 3300042643 Bacteria 4208
70 Ga0466704_605906 3300042643 Bacteria 35044
71 2227594082 2225789004 Unclassified 12767
72 Ga0466705_021697 3300042612 Bacteria 9820
73 Ga0466705_096757 3300042612 Bacteria 1710
74 Ga0562379_0045 3300056790 Bacteria 579951
75 Ga0562377_0319 3300056842 Unclassified 96869
76 Ga0562377_0358 3300056842 Unclassified 87064
77 Ga0123353_10084770 3300010167 Bacteria 5101
78 Ga0123353_10371265 3300010167 Bacteria 2145
79 Ga0160454_100323 3300012798 Bacteria 35852
80 Ga0160465_100021 3300012803 Bacteria 245261
81 Ga0466710_081059 3300042613 Bacteria 6615
82 Ga0466726_118718 3300042619 Bacteria 21537
83 Ga0160443_101861 3300012848 Bacteria 5806
84 Ga0160443_101947 3300012848 Bacteria 5491
85 Ga0160457_1001949 3300012858 Bacteria 4900
86 Ga0466693_047554 3300042592 Bacteria 4831
87 Ga0466707_288518 3300042601 Bacteria 153363
88 Ga0466722_085318 3300042609 Bacteria 5553
89 Ga0104050_1199780 3300007153 Bacteria 3788
90 Ga0562374_0097 3300057007 Unclassified 247554
91 Ga0466710_275799 3300042613 Bacteria 39037
92 Ga0466729_012060 3300042621 Bacteria 1421
93 Ga0160459_103364 3300012831 Bacteria 2318
94 Ga0255809_1027225 3300022820 Bacteria 2336
95 Ga0466657_076860 3300042582 Bacteria 3270
96 Ga0466704_184968 3300042643 Unclassified 13986
97 Ga0466708_220316 3300042652 Bacteria 10870
98 Ga0466725_184039 3300042654 Bacteria 4518
99 Ga0466725_285254 3300042654 Bacteria 86814
100 Ga0466701_095618 3300042598 Bacteria 2161
101 Ga0466714_029348 3300042603 Bacteria 10292
102 JGI24702J35022_10027454 3300002462 Unclassified 3063
103 Ga0562379_2581 3300056790 Unclassified 14615
104 Ga0562377_0368 3300056842 Unclassified 85022
105 Ga0160471_100110 3300012812 Bacteria 42140
106 Ga0466726_017086 3300042619 Bacteria 1921
107 Ga0466726_091348 3300042619 Bacteria 2332
108 Ga0466728_298051 3300042620 Bacteria 8122
109 Ga0160472_100003 3300012839 Bacteria 833437
110 Ga0466704_385792 3300042643 Bacteria 4261
111 Ga0466725_318275 3300042654 Bacteria 4964
112 IMNBL1DRAFT_c0001764 3300000062 Bacteria 15837

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02803 Thiolase_C Thiolase, C-terminal domain 337 457 0.98
PF00108 Thiolase_N Thiolase, N-terminal domain 80 328 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02803 GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.