Protein Family IF07253
Metagenome
Isolate
152
Members
71
Samples
132
Scaffolds
211.07
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_500146|Ga0466705_500146_303_1070
- Length
- 255 aa
- Sequence
- MIICSEDTLIKGILSSEQQSPLKYGGANFELSPPVPDRPRRFDMEELKPRERQILEFMKVQIARKGYPPTVREINAALGIKSTSTTHKDIERLENKGYIRKDPSKPRAIMIIDPSGSGPAGNVSADRHDIVEIPLVGRIAAGEPITSEQNIEEFVPVPAAYVKGENFMLKVQGDSMVDAGIFNGDLILVRQQQTADNGDIVVAMIDGFENEATVKTFYKEDGHIRLQPQNSTMSPIIVNDVTVLGKVRGVFRYLS
Sample Types
Isolate
13.2%
Metagenome
86.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Kalotermitidae
20.3%
Unclassified
17.4%
Blattidae
14.5%
Passalidae
4.3%
Termopsidae
4.3%
Rhinotermitidae
2.9%
Tenebrionidae
1.4%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
145
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 3 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 6 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 11 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 12 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 13 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 14 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 15 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 16 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 17 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 20 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 21 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 22 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 30 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 2820811576 | Unclassified Actinobacteria Nt197P3bin53 | Isolate | Unclassified |
| 37 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 38 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 43 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 44 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 45 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 46 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 49 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 50 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 51 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 52 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 53 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 54 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 55 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 56 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 57 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 58 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 59 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 60 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 61 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 62 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 63 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 64 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 65 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 66 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 67 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 68 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 69 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 70 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 71 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_092012 | 3300042612 | Bacteria | 1261 |
| 2 | Ga0466733_114121 | 3300042659 | Bacteria | 9996 |
| 3 | Ga0466706_107682 | 3300042599 | Unclassified | 3062 |
| 4 | Ga0466707_375862 | 3300042601 | Bacteria | 6650 |
| 5 | Ga0466713_054165 | 3300042602 | Bacteria | 4722 |
| 6 | Ga0466714_059644 | 3300042603 | Bacteria | 29769 |
| 7 | Ga0466717_277218 | 3300042604 | Bacteria | 3013 |
| 8 | Ga0466719_511311 | 3300042606 | Bacteria | 1213 |
| 9 | Ga0123355_10050113 | 3300009826 | Bacteria | 6786 |
| 10 | Ga0123354_10207698 | 3300010882 | Unclassified | 2128 |
| 11 | Ga0123354_10244536 | 3300010882 | Bacteria | 1836 |
| 12 | Ga0466692_189411 | 3300042591 | Bacteria | 8875 |
| 13 | Ga0466705_500146 | 3300042612 | Bacteria | 1248 |
| 14 | Ga0466728_064481 | 3300042620 | Bacteria | 3099 |
| 15 | Ga0466728_102679 | 3300042620 | Bacteria | 9345 |
| 16 | Ga0466703_221949 | 3300042636 | Bacteria | 1133 |
| 17 | Ga0466727_278491 | 3300042655 | Unclassified | 5406 |
| 18 | Ga0068302_10431661 | 3300005071 | Bacteria | 1092 |
| 19 | Ga0466707_020353 | 3300042601 | Bacteria | 1778 |
| 20 | Ga0466707_097664 | 3300042601 | Bacteria | 1068 |
| 21 | Ga0466713_083672 | 3300042602 | Bacteria | 2259 |
| 22 | Ga0466713_146655 | 3300042602 | Unclassified | 2648 |
| 23 | Ga0466719_389882 | 3300042606 | Bacteria | 4071 |
| 24 | Ga0123355_10098945 | 3300009826 | Bacteria | 4598 |
| 25 | Ga0123353_10051406 | 3300010167 | Bacteria | 6576 |
| 26 | Ga0123353_10200950 | 3300010167 | Bacteria | 3136 |
| 27 | Ga0123353_10408881 | 3300010167 | Bacteria | 2016 |
| 28 | Ga0123353_11359580 | 3300010167 | Bacteria | 917 |
| 29 | Ga0466701_011001 | 3300042598 | Bacteria | 1270 |
| 30 | Ga0466705_505278 | 3300042612 | Bacteria | 6125 |
| 31 | Ga0466734_100908 | 3300042623 | Bacteria | 2074 |
| 32 | Ga0466703_334577 | 3300042636 | Bacteria | 15759 |
| 33 | Ga0466708_002088 | 3300042652 | Bacteria | 4158 |
| 34 | Ga0466708_173241 | 3300042652 | Bacteria | 6534 |
| 35 | 2227358543 | 2225789004 | Bacteria | 130700 |
| 36 | IMNBL1DRAFT_c0000006 | 3300000062 | Bacteria | 247403 |
| 37 | IMNBL1DRAFT_c0019963 | 3300000062 | Unclassified | 2727 |
| 38 | IMNBL1DRAFT_c0028895 | 3300000062 | Bacteria | 2060 |
| 39 | JGI24705J35276_12238294 | 3300002504 | Bacteria | 18750 |
| 40 | Ga0072941_1223334 | 3300005201 | Bacteria | 989 |
| 41 | Ga0466706_071567 | 3300042599 | Bacteria | 8783 |
| 42 | Ga0466713_049964 | 3300042602 | Bacteria | 10595 |
| 43 | Ga0466719_055643 | 3300042606 | Bacteria | 1660 |
| 44 | Ga0466719_276360 | 3300042606 | Bacteria | 4066 |
| 45 | Ga0123355_10530573 | 3300009826 | Bacteria | 1434 |
| 46 | Ga0123354_10090553 | 3300010882 | Bacteria | 4234 |
| 47 | Ga0123354_10115361 | 3300010882 | Bacteria | 3511 |
| 48 | Ga0466694_154991 | 3300042594 | Bacteria | 2733 |
| 49 | Ga0466696_005815 | 3300042596 | Bacteria | 8413 |
| 50 | Ga0466704_115834 | 3300042643 | Bacteria | 49579 |
| 51 | Ga0466724_55877 | 3300042649 | Bacteria | 4568 |
| 52 | Ga0466708_134911 | 3300042652 | Bacteria | 1058 |
| 53 | Ga0466708_237126 | 3300042652 | Bacteria | 17704 |
| 54 | Ga0466725_061025 | 3300042654 | Bacteria | 1425 |
| 55 | JGI24705J35276_12188727 | 3300002504 | Bacteria | 1444 |
| 56 | Ga0466705_180877 | 3300042612 | Bacteria | 10314 |
| 57 | Ga0466707_404385 | 3300042601 | Bacteria | 5608 |
| 58 | Ga0466707_420054 | 3300042601 | Bacteria | 2046 |
| 59 | Ga0466716_280595 | 3300042605 | Bacteria | 1053 |
| 60 | Ga0466722_080045 | 3300042609 | Bacteria | 3495 |
| 61 | Ga0466715_461326 | 3300042616 | Bacteria | 4073 |
| 62 | Ga0466723_232922 | 3300042618 | Bacteria | 8946 |
| 63 | Ga0466708_131412 | 3300042652 | Bacteria | 35296 |
| 64 | IMNBL1DRAFT_c0000324 | 3300000062 | Bacteria | 40656 |
| 65 | Ga0072941_1432099 | 3300005201 | Bacteria | 3401 |
| 66 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 67 | Ga0466706_021009 | 3300042599 | Bacteria | 55440 |
| 68 | Ga0466713_052392 | 3300042602 | Bacteria | 216200 |
| 69 | Ga0466717_114107 | 3300042604 | Bacteria | 5697 |
| 70 | Ga0123353_10031843 | 3300010167 | Bacteria | 8178 |
| 71 | Ga0123353_11412638 | 3300010167 | Bacteria | 894 |
| 72 | Ga0123354_10065467 | 3300010882 | Bacteria | 5317 |
| 73 | Ga0160452_110396 | 3300012834 | Bacteria | 1135 |
| 74 | Ga0466691_017695 | 3300042593 | Bacteria | 6083 |
| 75 | Ga0466710_150753 | 3300042613 | Bacteria | 1043 |
| 76 | Ga0466728_105263 | 3300042620 | Bacteria | 3329 |
| 77 | Ga0466728_286612 | 3300042620 | Bacteria | 1897 |
| 78 | Ga0466702_243435 | 3300042635 | Bacteria | 3318 |
| 79 | 2227330786 | 2225789004 | Bacteria | 28531 |
| 80 | IMNBL1DRAFT_c0049400 | 3300000062 | Bacteria | 1342 |
| 81 | JGI24695J34938_10004017 | 3300002450 | Bacteria | 9894 |
| 82 | Ga0466705_196764 | 3300042612 | Bacteria | 1275 |
| 83 | Ga0466733_195460 | 3300042659 | Bacteria | 4621 |
| 84 | Ga0466707_083431 | 3300042601 | Bacteria | 3950 |
| 85 | Ga0466721_136209 | 3300042608 | Bacteria | 77160 |
| 86 | Ga0466692_036918 | 3300042591 | Bacteria | 18026 |
| 87 | Ga0466696_170012 | 3300042596 | Bacteria | 1937 |
| 88 | Ga0466726_428673 | 3300042619 | Unclassified | 1323 |
| 89 | Ga0466731_331742 | 3300042622 | Bacteria | 1521 |
| 90 | Ga0466734_071243 | 3300042623 | Bacteria | 1375 |
| 91 | Ga0466704_173376 | 3300042643 | Bacteria | 1825 |
| 92 | Ga0466708_206315 | 3300042652 | Bacteria | 7379 |
| 93 | Ga0466725_056529 | 3300042654 | Bacteria | 1104 |
| 94 | 2227253035 | 2225789004 | Bacteria | 7079 |
| 95 | JGI24702J35022_10043935 | 3300002462 | Bacteria | 2381 |
| 96 | Ga0466700_185234 | 3300042600 | Bacteria | 1054 |
| 97 | Ga0466707_165872 | 3300042601 | Bacteria | 1163 |
| 98 | Ga0466713_033410 | 3300042602 | Bacteria | 35675 |
| 99 | Ga0466716_058274 | 3300042605 | Bacteria | 5057 |
| 100 | Ga0466716_126932 | 3300042605 | Bacteria | 45619 |
| 101 | Ga0466719_056357 | 3300042606 | Bacteria | 10518 |
| 102 | Ga0123356_10500742 | 3300010049 | Bacteria | 1371 |
| 103 | Ga0466692_065539 | 3300042591 | Bacteria | 30371 |
| 104 | Ga0466691_083359 | 3300042593 | Bacteria | 22144 |
| 105 | Ga0466715_343745 | 3300042616 | Bacteria | 5548 |
| 106 | Ga0466728_053668 | 3300042620 | Bacteria | 5426 |
| 107 | Ga0466704_106790 | 3300042643 | Bacteria | 2227 |
| 108 | Ga0466709_366025 | 3300042648 | Bacteria | 5022 |
| 109 | Ga0466727_261360 | 3300042655 | Bacteria | 1561 |
| 110 | 2226991482 | 2225789003 | Bacteria | 7230 |
| 111 | 2227187742 | 2225789004 | Bacteria | 1475 |
| 112 | 2227646837 | 2225789004 | Bacteria | 42193 |
| 113 | Ga0466697_107487 | 3300042611 | Bacteria | 17354 |
| 114 | Ga0466705_261139 | 3300042612 | Bacteria | 2139 |
| 115 | Ga0466733_004107 | 3300042659 | Bacteria | 5547 |
| 116 | Ga0466706_233135 | 3300042599 | Bacteria | 4873 |
| 117 | Ga0466707_327496 | 3300042601 | Bacteria | 7172 |
| 118 | Ga0466697_042908 | 3300042611 | Bacteria | 2317 |
| 119 | Ga0123357_10040528 | 3300009784 | Bacteria | 6332 |
| 120 | Ga0123356_10158205 | 3300010049 | Bacteria | 2259 |
| 121 | Ga0123356_10867195 | 3300010049 | Bacteria | 1074 |
| 122 | Ga0123353_10080306 | 3300010167 | Bacteria | 5245 |
| 123 | Ga0123353_10162708 | 3300010167 | Bacteria | 3551 |
| 124 | Ga0466690_012691 | 3300042590 | Bacteria | 4011 |
| 125 | Ga0466690_390444 | 3300042590 | Bacteria | 1506 |
| 126 | Ga0466696_334121 | 3300042596 | Bacteria | 8833 |
| 127 | Ga0466711_096199 | 3300042615 | Bacteria | 8415 |
| 128 | Ga0466711_152227 | 3300042615 | Bacteria | 1580 |
| 129 | Ga0466723_002457 | 3300042618 | Bacteria | 13923 |
| 130 | Ga0466704_566009 | 3300042643 | Unclassified | 7342 |
| 131 | JGI24703J35330_11560415 | 3300002501 | Bacteria | 1251 |
| 132 | Ga0072941_1720106 | 3300005201 | Bacteria | 896 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.