Protein Family IF07237
Metagenome
Isolate
251
Members
163
Samples
153
Scaffolds
317.36
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_456115|Ga0466705_456115_809_1927
- Length
- 372 aa
- Sequence
- MYSLSVCFYKYKRSLIFGVVNWAPRSMDSGRERGYLFTVNEDGILKRIAGRAEAAGGRARMEKNARIYVAGHRGLVGSALVRALVAQGYENLLLRTRAELDLCDQGAVETFFAAERPEYVFLAAAKVGGIHANSTYPADFIRENLLVQCNVIDAARRHGCVKLLFPGSSCIYPKLCPQPIREEYLLSGPLEPTNECYALAKIAGLKMCAAYRAQYGFNAVSVMPSNLYGPGDNFHPENSHVLPALIRRFHEAARQAAPYVVIWGTGTARREFLHVDDLASAAIFIMRKYDSAEHINIGFGGDLTVMELARAVARTVGYTGDIRCDPSKPDGTPQKLLDISRITALGWKPSIDLEQGLADTYAWFLQQEELRS
Sample Types
Isolate
39.0%
Metagenome
61.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
35.3%
Unclassified
12.7%
Termitidae
12.0%
Kalotermitidae
8.0%
Culicidae
4.0%
Formicidae
3.3%
Armadillidiidae
3.3%
Rhinotermitidae
2.7%
Curculionidae
2.0%
Termopsidae
2.0%
Largidae
1.3%
Apidae
1.3%
Alydidae
1.3%
Tephritidae
1.3%
Berytidae
1.3%
Aleyrodidae
0.7%
Thomisidae
0.7%
Hydrophilidae
0.7%
Passalidae
0.7%
Hodotermitidae
0.7%
Bombycidae
0.7%
Anthocoridae
0.7%
Daphniidae
0.7%
Nephropidae
0.7%
Siricidae
0.7%
Gryllidae
0.7%
Drosophilidae
0.7%
Taxonomy
Archaea
0
Bacteria
242
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 2 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 3 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 4 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 5 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 6 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 13 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 14 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 15 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 16 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 17 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 22 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 23 | 2820072841 | Unclassified Proteobacteria Nt197P3bin127 | Isolate | Unclassified |
| 24 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 25 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 26 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 27 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 28 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 33 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 34 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 35 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 36 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 37 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 38 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 39 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 40 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 41 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 46 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 47 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 48 | 2820148564 | Unclassified Proteobacteria Emb289P1bin36 | Isolate | Unclassified |
| 49 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 50 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 51 | 2918394494 | Microbacterium imperiale DSM 20530 | Isolate | Unclassified |
| 52 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 53 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 54 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 55 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 56 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 57 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 58 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 59 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 60 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 61 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 62 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 63 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 64 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 65 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 66 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 67 | 2821312900 | Unclassified Proteobacteria Lab288P4bin16 | Isolate | Unclassified |
| 68 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 69 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 70 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 71 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 72 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 73 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 74 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 75 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 76 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 77 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 78 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 79 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 80 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 81 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 82 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 83 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 84 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 85 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 86 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 87 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 88 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 89 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 90 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 91 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 92 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 93 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 94 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 95 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 96 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 97 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 98 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 99 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 100 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 101 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 102 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 103 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 104 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 105 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 106 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 107 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 108 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 109 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 110 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 111 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 112 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 113 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 114 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 115 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 116 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 117 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 118 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 119 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 120 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 121 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 122 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 123 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 124 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 125 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 126 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 127 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 128 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 129 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 130 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 131 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 132 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 133 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 134 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 135 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 136 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 137 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 138 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 139 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 140 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 141 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 142 | 2820176377 | Unclassified Planctomycetes Th196P3bin111 | Isolate | Unclassified |
| 143 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 144 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 145 | 2931430189 | Tessaracoccus palaemonis J1M15 | Isolate | |
| 146 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 147 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 148 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 149 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 150 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 151 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 152 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 153 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 154 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 155 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 156 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 157 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 158 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 159 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 160 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 161 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 162 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 163 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466716_228390 | 3300042605 | Bacteria | 4409 |
| 2 | Ga0466698_071743 | 3300042610 | Bacteria | 8935 |
| 3 | Ga0123357_10090685 | 3300009784 | Bacteria | 3985 |
| 4 | Ga0123355_10026728 | 3300009826 | Bacteria | 9313 |
| 5 | Ga0123355_10120192 | 3300009826 | Unclassified | 4078 |
| 6 | Ga0123355_10467972 | 3300009826 | Bacteria | 1577 |
| 7 | Ga0466703_061840 | 3300042636 | Bacteria | 2782 |
| 8 | Ga0466703_411701 | 3300042636 | Bacteria | 7729 |
| 9 | Ga0466708_252247 | 3300042652 | Bacteria | 13096 |
| 10 | Ga0466711_303380 | 3300042615 | Bacteria | 2211 |
| 11 | Ga0466726_359862 | 3300042619 | Bacteria | 36577 |
| 12 | Ga0466726_442039 | 3300042619 | Bacteria | 3543 |
| 13 | Ga0415639_006384 | 3300038395 | Bacteria | 18820 |
| 14 | Ga0466692_108272 | 3300042591 | Bacteria | 5844 |
| 15 | Ga0466696_495612 | 3300042596 | Bacteria | 12760 |
| 16 | Ga0466713_087656 | 3300042602 | Bacteria | 20607 |
| 17 | Ga0123355_10122990 | 3300009826 | Bacteria | 4020 |
| 18 | Ga0123356_10595852 | 3300010049 | Unclassified | 1270 |
| 19 | Ga0123353_10341172 | 3300010167 | Bacteria | 2263 |
| 20 | Ga0466734_036359 | 3300042623 | Bacteria | 13681 |
| 21 | Ga0466703_000112 | 3300042636 | Bacteria | 13081 |
| 22 | Ga0466703_162466 | 3300042636 | Bacteria | 21407 |
| 23 | FGTW_contig11832 | 2065487013 | Bacteria | 7679 |
| 24 | WW0001_100134 | 3300002732 | Bacteria | 240561 |
| 25 | Ga0466711_175373 | 3300042615 | Bacteria | 43795 |
| 26 | Ga0466711_198696 | 3300042615 | Bacteria | 6310 |
| 27 | Ga0466715_107160 | 3300042616 | Bacteria | 28699 |
| 28 | Ga0160433_100441 | 3300012846 | Unclassified | 21505 |
| 29 | Ga0160433_102732 | 3300012846 | Bacteria | 3580 |
| 30 | Ga0160445_106525 | 3300012847 | Bacteria | 1898 |
| 31 | Ga0160435_1000236 | 3300012857 | Bacteria | 26109 |
| 32 | Ga0466690_043179 | 3300042590 | Bacteria | 4175 |
| 33 | Ga0466705_173790 | 3300042612 | Bacteria | 7924 |
| 34 | Ga0466705_247256 | 3300042612 | Bacteria | 10363 |
| 35 | Ga0466722_044060 | 3300042609 | Bacteria | 3413 |
| 36 | Ga0466698_360064 | 3300042610 | Bacteria | 2752 |
| 37 | Ga0466698_498766 | 3300042610 | Bacteria | 6058 |
| 38 | Ga0123356_10239407 | 3300010049 | Bacteria | 1885 |
| 39 | Ga0123356_10259800 | 3300010049 | Bacteria | 1820 |
| 40 | Ga0160464_100009 | 3300012805 | Bacteria | 325341 |
| 41 | Ga0466729_246293 | 3300042621 | Bacteria | 182374 |
| 42 | Ga0466731_305906 | 3300042622 | Bacteria | 1613 |
| 43 | Ga0466703_071340 | 3300042636 | Bacteria | 2918 |
| 44 | Ga0466708_232353 | 3300042652 | Bacteria | 129711 |
| 45 | Ga0466708_323940 | 3300042652 | Bacteria | 18001 |
| 46 | Ga0466727_181029 | 3300042655 | Bacteria | 14375 |
| 47 | FGTW_contig31084 | 2065487013 | Bacteria | 6380 |
| 48 | JGI24705J35276_12149818 | 3300002504 | Bacteria | 1178 |
| 49 | Ga0103261_1000033 | 3300007083 | Bacteria | 87612 |
| 50 | Ga0102734_1006011 | 3300007129 | Bacteria | 3470 |
| 51 | Ga0103264_1000182 | 3300007188 | Bacteria | 37428 |
| 52 | Ga0466711_218509 | 3300042615 | Bacteria | 19081 |
| 53 | Ga0466715_161244 | 3300042616 | Bacteria | 10688 |
| 54 | Ga0466715_163167 | 3300042616 | Bacteria | 1203 |
| 55 | Ga0466715_163430 | 3300042616 | Bacteria | 12167 |
| 56 | Ga0466729_088380 | 3300042621 | Bacteria | 2389 |
| 57 | Ga0160469_100015 | 3300012824 | Bacteria | 373407 |
| 58 | Ga0160448_101819 | 3300012854 | Bacteria | 6808 |
| 59 | Ga0466695_219101 | 3300042595 | Bacteria | 1175 |
| 60 | Ga0466696_330098 | 3300042596 | Bacteria | 3410 |
| 61 | Ga0466705_114791 | 3300042612 | Bacteria | 1158 |
| 62 | Ga0466705_300996 | 3300042612 | Bacteria | 3423 |
| 63 | Ga0466721_105247 | 3300042608 | Unclassified | 1515 |
| 64 | Ga0123355_10193811 | 3300009826 | Bacteria | 2985 |
| 65 | Ga0123355_10313629 | 3300009826 | Bacteria | 2122 |
| 66 | Ga0123354_10000004 | 3300010882 | Bacteria | 302459 |
| 67 | Ga0123354_10000072 | 3300010882 | Bacteria | 76600 |
| 68 | Ga0466735_017579 | 3300042624 | Bacteria | 10094 |
| 69 | Ga0466735_164364 | 3300042624 | Bacteria | 1050 |
| 70 | Ga0466703_016393 | 3300042636 | Bacteria | 3761 |
| 71 | Ga0466704_561017 | 3300042643 | Bacteria | 4735 |
| 72 | Ga0466709_296945 | 3300042648 | Bacteria | 1202 |
| 73 | Ga0466708_258031 | 3300042652 | Bacteria | 97414 |
| 74 | Ga0466725_403184 | 3300042654 | Bacteria | 4177 |
| 75 | SPBB_contig03540 | 2044078006 | Bacteria | 63375 |
| 76 | Ga0123357_10002413 | 3300009784 | Bacteria | 20836 |
| 77 | Ga0466715_500910 | 3300042616 | Bacteria | 5251 |
| 78 | Ga0466718_019767 | 3300042617 | Bacteria | 7184 |
| 79 | Ga0466723_044505 | 3300042618 | Bacteria | 2686 |
| 80 | Ga0466723_253640 | 3300042618 | Bacteria | 1538 |
| 81 | Ga0466726_351877 | 3300042619 | Bacteria | 2136 |
| 82 | Ga0160458_105817 | 3300012832 | Bacteria | 1454 |
| 83 | Ga0160444_100012 | 3300012841 | Bacteria | 428907 |
| 84 | Ga0466705_316131 | 3300042612 | Bacteria | 1419 |
| 85 | Ga0466707_329962 | 3300042601 | Bacteria | 2878 |
| 86 | Ga0160465_100058 | 3300012803 | Bacteria | 124472 |
| 87 | Ga0466704_057833 | 3300042643 | Unclassified | 2038 |
| 88 | Ga0466704_155932 | 3300042643 | Bacteria | 15582 |
| 89 | Ga0466724_25680 | 3300042649 | Bacteria | 9309 |
| 90 | Ga0103260_1000178 | 3300007139 | Bacteria | 14123 |
| 91 | Ga0466705_456115 | 3300042612 | Bacteria | 3470 |
| 92 | Ga0466711_110923 | 3300042615 | Bacteria | 9092 |
| 93 | Ga0466711_213989 | 3300042615 | Bacteria | 10135 |
| 94 | Ga0466715_570949 | 3300042616 | Bacteria | 10244 |
| 95 | Ga0466723_315871 | 3300042618 | Bacteria | 31895 |
| 96 | Ga0466726_079589 | 3300042619 | Bacteria | 35525 |
| 97 | Ga0160459_100019 | 3300012831 | Bacteria | 370950 |
| 98 | Ga0466696_266952 | 3300042596 | Bacteria | 1601 |
| 99 | Ga0466733_200059 | 3300042659 | Bacteria | 44789 |
| 100 | Ga0466706_234010 | 3300042599 | Bacteria | 1548 |
| 101 | Ga0466716_463731 | 3300042605 | Unclassified | 32929 |
| 102 | Ga0123355_10206795 | 3300009826 | Bacteria | 2854 |
| 103 | Ga0123353_10262449 | 3300010167 | Bacteria | 2666 |
| 104 | Ga0466703_103794 | 3300042636 | Bacteria | 6558 |
| 105 | Ga0466709_071434 | 3300042648 | Bacteria | 7453 |
| 106 | Ga0466708_434825 | 3300042652 | Bacteria | 19165 |
| 107 | Ga0466725_021422 | 3300042654 | Bacteria | 27571 |
| 108 | IMNBGM34_c000232 | 3300000036 | Bacteria | 16190 |
| 109 | Ga0102734_1000339 | 3300007129 | Bacteria | 14438 |
| 110 | Ga0466723_015013 | 3300042618 | Bacteria | 3055 |
| 111 | Ga0466723_118771 | 3300042618 | Bacteria | 4682 |
| 112 | Ga0466726_279914 | 3300042619 | Bacteria | 4838 |
| 113 | Ga0160440_100166 | 3300012815 | Unclassified | 57137 |
| 114 | Ga0160452_100568 | 3300012834 | Bacteria | 21252 |
| 115 | Ga0160433_100273 | 3300012846 | Bacteria | 35562 |
| 116 | Ga0160435_1000337 | 3300012857 | Bacteria | 19144 |
| 117 | Ga0466657_330303 | 3300042582 | Bacteria | 2755 |
| 118 | Ga0466705_113623 | 3300042612 | Bacteria | 2288 |
| 119 | Ga0466705_269072 | 3300042612 | Bacteria | 3214 |
| 120 | Ga0466705_382083 | 3300042612 | Bacteria | 8459 |
| 121 | Ga0466722_088384 | 3300042609 | Bacteria | 12982 |
| 122 | Ga0123356_10011431 | 3300010049 | Bacteria | 8653 |
| 123 | Ga0123354_10007985 | 3300010882 | Bacteria | 16048 |
| 124 | Ga0466703_183310 | 3300042636 | Bacteria | 17595 |
| 125 | Ga0466703_366247 | 3300042636 | Bacteria | 1353 |
| 126 | Ga0466704_080327 | 3300042643 | Unclassified | 28572 |
| 127 | HBC_ctgsDRAFT_1000255 | 3300000333 | Bacteria | 12278 |
| 128 | JGI24703J35330_11748872 | 3300002501 | Bacteria | 111701 |
| 129 | Ga0072941_1050718 | 3300005201 | Bacteria | 6985 |
| 130 | Ga0102738_1000070 | 3300007141 | Bacteria | 41068 |
| 131 | Ga0466711_032812 | 3300042615 | Bacteria | 1608 |
| 132 | Ga0466711_258618 | 3300042615 | Bacteria | 6044 |
| 133 | Ga0466715_209279 | 3300042616 | Bacteria | 9385 |
| 134 | Ga0160469_100071 | 3300012824 | Bacteria | 171968 |
| 135 | Ga0160447_100013 | 3300012849 | Bacteria | 365997 |
| 136 | Ga0160434_100006 | 3300012850 | Bacteria | 403207 |
| 137 | Ga0160457_1000028 | 3300012858 | Bacteria | 284184 |
| 138 | Ga0466696_429505 | 3300042596 | Bacteria | 1521 |
| 139 | Ga0466705_154153 | 3300042612 | Bacteria | 12226 |
| 140 | Ga0466705_190283 | 3300042612 | Bacteria | 1905 |
| 141 | Ga0466707_066689 | 3300042601 | Bacteria | 1757 |
| 142 | Ga0466719_327244 | 3300042606 | Bacteria | 11780 |
| 143 | Ga0123356_10105601 | 3300010049 | Bacteria | 2710 |
| 144 | Ga0466703_293193 | 3300042636 | Bacteria | 1252 |
| 145 | Ga0466703_341015 | 3300042636 | Bacteria | 11925 |
| 146 | Ga0466704_372172 | 3300042643 | Bacteria | 33142 |
| 147 | Ga0466708_135327 | 3300042652 | Bacteria | 12406 |
| 148 | Ga0466725_128830 | 3300042654 | Bacteria | 24699 |
| 149 | Ga0104045_1006477 | 3300007085 | Bacteria | 3642 |
| 150 | Ga0466715_391519 | 3300042616 | Bacteria | 2282 |
| 151 | Ga0466723_014596 | 3300042618 | Bacteria | 2337 |
| 152 | Ga0160434_100142 | 3300012850 | Bacteria | 38364 |
| 153 | Ga0160457_1004082 | 3300012858 | Unclassified | 2405 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.