Protein Family IF07235
Metagenome
Isolate
194
Members
45
Samples
186
Scaffolds
177.13
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_451017|Ga0466705_451017_4068_4661
- Length
- 197 aa
- Sequence
- MTHEIIVSGFGGQGVLLLGQLLGQAGMEEGRNVSWLPSYGPEMRGGTAYCSVIISDERIGSPVVEEPTLLVAMNLPSMLRFAPALRPGGILVANVSLISARPERKDITLIEVPMNDLAAELRNPRGLNVIGLGVVAGLGTVVGRRAAEQALNKMFGEKFASKPDLLELNRKTFEQGTIAAGCGIAAACAPAEQGNSR
Sample Types
Isolate
4.1%
Metagenome
95.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.0%
Kalotermitidae
26.7%
Unclassified
17.8%
Passalidae
4.4%
Rhinotermitidae
4.4%
Termopsidae
4.4%
Hodotermitidae
2.2%
Taxonomy
Archaea
1
Bacteria
180
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 4 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 5 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 6 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 7 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 8 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 18 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 19 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 32 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 33 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 39 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 42 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 43 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 44 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 45 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_461809 | 3300042612 | Bacteria | 1652 |
| 2 | Ga0466715_642731 | 3300042616 | Bacteria | 1991 |
| 3 | Ga0123355_10000436 | 3300009826 | Bacteria | 54934 |
| 4 | Ga0123355_10220018 | 3300009826 | Bacteria | 2733 |
| 5 | Ga0123356_10001222 | 3300010049 | Bacteria | 28515 |
| 6 | Ga0123356_10010083 | 3300010049 | Bacteria | 9291 |
| 7 | Ga0123356_10091581 | 3300010049 | Bacteria | 2898 |
| 8 | Ga0123356_10107386 | 3300010049 | Bacteria | 2689 |
| 9 | Ga0123356_10208750 | 3300010049 | Bacteria | 1999 |
| 10 | Ga0123356_10227028 | 3300010049 | Bacteria | 1928 |
| 11 | Ga0123356_10389313 | 3300010049 | Bacteria | 1529 |
| 12 | Ga0123356_10416007 | 3300010049 | Bacteria | 1485 |
| 13 | Ga0123356_10435673 | 3300010049 | Bacteria | 1456 |
| 14 | Ga0123356_10461905 | 3300010049 | Bacteria | 1419 |
| 15 | Ga0123356_10473201 | 3300010049 | Bacteria | 1405 |
| 16 | Ga0123356_10507952 | 3300010049 | Bacteria | 1362 |
| 17 | Ga0123356_10639060 | 3300010049 | Bacteria | 1231 |
| 18 | Ga0123353_10313167 | 3300010167 | Bacteria | 2387 |
| 19 | Ga0123353_10987105 | 3300010167 | Bacteria | 1133 |
| 20 | Ga0123353_11770549 | 3300010167 | Bacteria | 769 |
| 21 | Ga0123354_10571002 | 3300010882 | Unclassified | 843 |
| 22 | Ga0466729_249615 | 3300042621 | Bacteria | 4550 |
| 23 | Ga0466730_058918 | 3300042625 | Bacteria | 2148 |
| 24 | Ga0466704_054637 | 3300042643 | Bacteria | 53502 |
| 25 | 2227478166 | 2225789004 | Bacteria | 869 |
| 26 | JGI24702J35022_10407871 | 3300002462 | Bacteria | 822 |
| 27 | Ga0466705_437303 | 3300042612 | Bacteria | 1474 |
| 28 | Ga0466718_027300 | 3300042617 | Bacteria | 2093 |
| 29 | Ga0123355_10002433 | 3300009826 | Bacteria | 26301 |
| 30 | Ga0123355_10028062 | 3300009826 | Bacteria | 9097 |
| 31 | Ga0123355_10541479 | 3300009826 | Unclassified | 1413 |
| 32 | Ga0123356_10131658 | 3300010049 | Bacteria | 2451 |
| 33 | Ga0123356_10396202 | 3300010049 | Bacteria | 1517 |
| 34 | Ga0123356_11896798 | 3300010049 | Bacteria | 742 |
| 35 | Ga0123356_11992193 | 3300010049 | Unclassified | 724 |
| 36 | Ga0123356_12382404 | 3300010049 | Bacteria | 662 |
| 37 | Ga0123353_10019424 | 3300010167 | Bacteria | 10097 |
| 38 | Ga0123353_10022333 | 3300010167 | Bacteria | 9536 |
| 39 | Ga0123353_10107361 | 3300010167 | Bacteria | 4499 |
| 40 | Ga0123353_10125242 | 3300010167 | Bacteria | 4129 |
| 41 | Ga0123353_10393141 | 3300010167 | Bacteria | 2067 |
| 42 | Ga0123353_10609016 | 3300010167 | Bacteria | 1559 |
| 43 | Ga0123353_11711281 | 3300010167 | Bacteria | 787 |
| 44 | Ga0123353_12040538 | 3300010167 | Bacteria | 701 |
| 45 | Ga0123354_10198409 | 3300010882 | Bacteria | 2217 |
| 46 | Ga0466691_217068 | 3300042593 | Bacteria | 13415 |
| 47 | Ga0466709_131926 | 3300042648 | Bacteria | 4438 |
| 48 | JGI24705J35276_12227203 | 3300002504 | Bacteria | 2963 |
| 49 | Ga0466723_319755 | 3300042618 | Bacteria | 2242 |
| 50 | Ga0466728_485549 | 3300042620 | Bacteria | 1856 |
| 51 | Ga0123355_10001348 | 3300009826 | Bacteria | 34067 |
| 52 | Ga0123356_10003578 | 3300010049 | Bacteria | 16238 |
| 53 | Ga0123356_10015548 | 3300010049 | Bacteria | 7289 |
| 54 | Ga0123356_10045676 | 3300010049 | Bacteria | 4075 |
| 55 | Ga0123356_10127183 | 3300010049 | Unclassified | 2490 |
| 56 | Ga0123356_10194552 | 3300010049 | Bacteria | 2062 |
| 57 | Ga0123356_10446682 | 3300010049 | Bacteria | 1440 |
| 58 | Ga0123356_10568177 | 3300010049 | Bacteria | 1296 |
| 59 | Ga0123356_10591988 | 3300010049 | Archaea | 1273 |
| 60 | Ga0123356_10698207 | 3300010049 | Bacteria | 1183 |
| 61 | Ga0123356_10702328 | 3300010049 | Bacteria | 1180 |
| 62 | Ga0123356_10858748 | 3300010049 | Bacteria | 1079 |
| 63 | Ga0123356_10900818 | 3300010049 | Bacteria | 1056 |
| 64 | Ga0123356_11567636 | 3300010049 | Bacteria | 814 |
| 65 | Ga0123353_10002547 | 3300010167 | Bacteria | 22647 |
| 66 | Ga0123353_10977376 | 3300010167 | Bacteria | 1141 |
| 67 | Ga0123353_11349668 | 3300010167 | Bacteria | 921 |
| 68 | Ga0123353_11387439 | 3300010167 | Unclassified | 904 |
| 69 | Ga0123353_11573551 | 3300010167 | Bacteria | 832 |
| 70 | Ga0123354_10367125 | 3300010882 | Unclassified | 1261 |
| 71 | Ga0466703_220189 | 3300042636 | Bacteria | 2800 |
| 72 | Ga0466703_354933 | 3300042636 | Bacteria | 2172 |
| 73 | Ga0466708_386308 | 3300042652 | Bacteria | 8187 |
| 74 | IMNBL1DRAFT_c0006513 | 3300000062 | Unclassified | 6363 |
| 75 | JGI24702J35022_10020811 | 3300002462 | Bacteria | 3558 |
| 76 | Ga0466714_139536 | 3300042603 | Bacteria | 1169 |
| 77 | Ga0466721_264631 | 3300042608 | Bacteria | 4944 |
| 78 | Ga0466722_264255 | 3300042609 | Bacteria | 3129 |
| 79 | Ga0466705_451017 | 3300042612 | Bacteria | 11699 |
| 80 | Ga0123355_10011880 | 3300009826 | Bacteria | 13453 |
| 81 | Ga0123355_10497746 | 3300009826 | Bacteria | 1505 |
| 82 | Ga0123355_11320195 | 3300009826 | Bacteria | 722 |
| 83 | Ga0123356_10000760 | 3300010049 | Bacteria | 35664 |
| 84 | Ga0123356_10003182 | 3300010049 | Bacteria | 17261 |
| 85 | Ga0123356_10033638 | 3300010049 | Bacteria | 4794 |
| 86 | Ga0123356_10036118 | 3300010049 | Bacteria | 4615 |
| 87 | Ga0123356_10056128 | 3300010049 | Bacteria | 3668 |
| 88 | Ga0123356_10087502 | 3300010049 | Bacteria | 2960 |
| 89 | Ga0123356_10226670 | 3300010049 | Bacteria | 1930 |
| 90 | Ga0123356_10515518 | 3300010049 | Bacteria | 1353 |
| 91 | Ga0123356_10783943 | 3300010049 | Unclassified | 1124 |
| 92 | Ga0123353_10018636 | 3300010167 | Bacteria | 10272 |
| 93 | Ga0123353_10062386 | 3300010167 | Bacteria | 5978 |
| 94 | Ga0123353_10178188 | 3300010167 | Bacteria | 3368 |
| 95 | Ga0123353_10181576 | 3300010167 | Bacteria | 3330 |
| 96 | Ga0123353_10291950 | 3300010167 | Bacteria | 2495 |
| 97 | Ga0123353_10318773 | 3300010167 | Bacteria | 2360 |
| 98 | Ga0123353_11191857 | 3300010167 | Bacteria | 1000 |
| 99 | Ga0123353_11420236 | 3300010167 | Bacteria | 890 |
| 100 | Ga0123353_12053425 | 3300010167 | Bacteria | 698 |
| 101 | Ga0123354_10128001 | 3300010882 | Bacteria | 3229 |
| 102 | Ga0466696_122069 | 3300042596 | Bacteria | 1579 |
| 103 | Ga0466727_180366 | 3300042655 | Bacteria | 9459 |
| 104 | Ga0466727_289706 | 3300042655 | Bacteria | 3135 |
| 105 | 2227479068 | 2225789004 | Bacteria | 4517 |
| 106 | Ga0466701_033241 | 3300042598 | Bacteria | 6531 |
| 107 | Ga0466716_487486 | 3300042605 | Bacteria | 1079 |
| 108 | Ga0123355_10559284 | 3300009826 | Bacteria | 1379 |
| 109 | Ga0123356_10011548 | 3300010049 | Bacteria | 8604 |
| 110 | Ga0123356_10014250 | 3300010049 | Bacteria | 7648 |
| 111 | Ga0123356_10054940 | 3300010049 | Bacteria | 3708 |
| 112 | Ga0123356_10071591 | 3300010049 | Bacteria | 3255 |
| 113 | Ga0123356_10089874 | 3300010049 | Bacteria | 2923 |
| 114 | Ga0123356_10337630 | 3300010049 | Bacteria | 1626 |
| 115 | Ga0123356_10354842 | 3300010049 | Bacteria | 1591 |
| 116 | Ga0123356_10631328 | 3300010049 | Bacteria | 1237 |
| 117 | Ga0123356_11067194 | 3300010049 | Bacteria | 977 |
| 118 | Ga0123353_11026939 | 3300010167 | Bacteria | 1104 |
| 119 | Ga0123353_11257904 | 3300010167 | Unclassified | 965 |
| 120 | Ga0123354_10212508 | 3300010882 | Bacteria | 2085 |
| 121 | Ga0415639_005931 | 3300038395 | Bacteria | 7610 |
| 122 | Ga0466702_287383 | 3300042635 | Bacteria | 1172 |
| 123 | Ga0466703_086607 | 3300042636 | Bacteria | 64365 |
| 124 | Ga0466704_568987 | 3300042643 | Bacteria | 4816 |
| 125 | 2227668225 | 2225789004 | Bacteria | 1912 |
| 126 | JGI24702J35022_10209827 | 3300002462 | Bacteria | 1118 |
| 127 | Ga0466706_255088 | 3300042599 | Bacteria | 1458 |
| 128 | Ga0466705_043383 | 3300042612 | Bacteria | 43788 |
| 129 | Ga0466723_264001 | 3300042618 | Bacteria | 2328 |
| 130 | Ga0123355_10003584 | 3300009826 | Bacteria | 22338 |
| 131 | Ga0123355_10653252 | 3300009826 | Bacteria | 1226 |
| 132 | Ga0123356_10487114 | 3300010049 | Bacteria | 1387 |
| 133 | Ga0123356_10694730 | 3300010049 | Bacteria | 1186 |
| 134 | Ga0123356_10723709 | 3300010049 | Bacteria | 1165 |
| 135 | Ga0123356_12227260 | 3300010049 | Bacteria | 685 |
| 136 | Ga0123353_10070756 | 3300010167 | Bacteria | 5606 |
| 137 | Ga0123353_10200349 | 3300010167 | Bacteria | 3141 |
| 138 | Ga0123353_10205744 | 3300010167 | Bacteria | 3092 |
| 139 | Ga0123353_10377658 | 3300010167 | Bacteria | 2122 |
| 140 | Ga0123353_10595599 | 3300010167 | Bacteria | 1582 |
| 141 | Ga0123354_10498146 | 3300010882 | Unclassified | 951 |
| 142 | Ga0466693_029221 | 3300042592 | Bacteria | 1645 |
| 143 | Ga0466696_457036 | 3300042596 | Bacteria | 6173 |
| 144 | Ga0466702_027325 | 3300042635 | Bacteria | 1149 |
| 145 | Ga0466733_024073 | 3300042659 | Bacteria | 12650 |
| 146 | Ga0466705_463820 | 3300042612 | Bacteria | 1178 |
| 147 | Ga0466728_399627 | 3300042620 | Bacteria | 23793 |
| 148 | Ga0123356_10062598 | 3300010049 | Bacteria | 3476 |
| 149 | Ga0123356_10102277 | 3300010049 | Bacteria | 2750 |
| 150 | Ga0123356_10501980 | 3300010049 | Bacteria | 1369 |
| 151 | Ga0123356_10833533 | 3300010049 | Bacteria | 1093 |
| 152 | Ga0123356_10870647 | 3300010049 | Unclassified | 1072 |
| 153 | Ga0123356_11262529 | 3300010049 | Bacteria | 903 |
| 154 | Ga0123356_11399642 | 3300010049 | Bacteria | 860 |
| 155 | Ga0123353_10017321 | 3300010167 | Bacteria | 10583 |
| 156 | Ga0123353_10056363 | 3300010167 | Bacteria | 6289 |
| 157 | Ga0123353_10699516 | 3300010167 | Bacteria | 1423 |
| 158 | Ga0123353_10716415 | 3300010167 | Bacteria | 1401 |
| 159 | Ga0123353_10851165 | 3300010167 | Bacteria | 1250 |
| 160 | Ga0123353_11289420 | 3300010167 | Bacteria | 949 |
| 161 | Ga0466694_007328 | 3300042594 | Bacteria | 2665 |
| 162 | JGI24702J35022_10003516 | 3300002462 | Bacteria | 9435 |
| 163 | Ga0068302_10045370 | 3300005071 | Bacteria | 5514 |
| 164 | Ga0072940_1188313 | 3300005200 | Bacteria | 1309 |
| 165 | Ga0466717_018294 | 3300042604 | Unclassified | 1765 |
| 166 | Ga0466716_082850 | 3300042605 | Bacteria | 1482 |
| 167 | Ga0466721_211688 | 3300042608 | Bacteria | 1604 |
| 168 | Ga0466715_146974 | 3300042616 | Bacteria | 1894 |
| 169 | Ga0123355_10016171 | 3300009826 | Bacteria | 11746 |
| 170 | Ga0123356_10006956 | 3300010049 | Bacteria | 11355 |
| 171 | Ga0123356_10113314 | 3300010049 | Bacteria | 2623 |
| 172 | Ga0123356_10123175 | 3300010049 | Bacteria | 2526 |
| 173 | Ga0123356_10247261 | 3300010049 | Bacteria | 1859 |
| 174 | Ga0123356_10395808 | 3300010049 | Bacteria | 1518 |
| 175 | Ga0123356_10964638 | 3300010049 | Bacteria | 1023 |
| 176 | Ga0123356_11205575 | 3300010049 | Bacteria | 923 |
| 177 | Ga0123356_12239719 | 3300010049 | Bacteria | 683 |
| 178 | Ga0123353_10097703 | 3300010167 | Bacteria | 4733 |
| 179 | Ga0123353_10181598 | 3300010167 | Bacteria | 3330 |
| 180 | Ga0123353_10613412 | 3300010167 | Unclassified | 1551 |
| 181 | Ga0466709_288814 | 3300042648 | Bacteria | 4869 |
| 182 | JGI24702J35022_10175380 | 3300002462 | Bacteria | 1215 |
| 183 | Ga0466717_090771 | 3300042604 | Bacteria | 1248 |
| 184 | Ga0466717_240766 | 3300042604 | Bacteria | 1024 |
| 185 | Ga0466719_286231 | 3300042606 | Bacteria | 1297 |
| 186 | Ga0466721_393227 | 3300042608 | Bacteria | 13816 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01558 | POR | Pyruvate ferredoxin/flavodoxin oxidoreductase | 11 | 176 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01558 | GO:0016903 | oxidoreductase activity, acting on the aldehyde or oxo group of donors | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.