Protein Family IF07215
Metagenome
Isolate
169
Members
78
Samples
137
Scaffolds
479.33
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_392662|Ga0466705_392662_779_2458
- Length
- 547 aa
- Sequence
- MKKPLPGKKVFYREIQLGIKKRADREVCLFCMSGMSSTCICPGNYLLTAASSVFIMYLCGDKSSMEGWDILIIWLTGGKNSNNTAFFSGNKRSPWYIISIGMIGTSLSGVTFVSVPGLVRQMDMTYMQVVFGFFFGYILIARILLPLYYRLNLTSIYSWLDDRIGPRGYRTGACFFLLSKLVGAAARLYLVVWILQTCVFDRWHIPFAVTATASVFLVWLYTFRGGIRTIIWTDTLQALCLLAMLGGILWQVKHSLALDMAGMVQTVTASEHFRIFEFKDWASTQHFVKQFLSGIFIPVVMTGLDQDMMQKNLACRNLRDAQRNMYTYGIAFIPVNFLFLCLGILLLTLAAQQQIALPDVNDDILPMFCTSGILGYSTLIFFTVGIIAAAFSSADSALTALTTSFCVDILGLEKDKTEKARRTRMRVHLLVALVFXXXIILFRLFSSRSLIDAIYMIASFTYGPLLGLFAFGLFTRRKPLNRPVPYICIAAPLICYALDYFVFKYAGYKFGYEILLLNGALTFAGLWFRSEKKAFCPYRRAKAFRPY
Sample Types
Isolate
18.9%
Metagenome
81.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
25.6%
Termitidae
25.6%
Kalotermitidae
16.7%
Unclassified
14.1%
Rhinotermitidae
6.4%
Termopsidae
5.1%
Hydrophilidae
2.6%
Passalidae
2.6%
Hodotermitidae
1.3%
Taxonomy
Archaea
0
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 2 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 3 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 4 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 14 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 15 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 16 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 17 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 24 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 29 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 30 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 31 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 32 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 35 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 36 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 37 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 38 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 45 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 46 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 47 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 48 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 49 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 50 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 51 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 52 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 53 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 54 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 55 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 56 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 57 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 58 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 59 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 60 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 61 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 62 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 63 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 64 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 65 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 66 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 67 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 68 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 69 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 70 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 71 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 72 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 73 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 74 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 75 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 76 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 77 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 78 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466656_218669 | 3300042550 | Bacteria | 33170 |
| 2 | Ga0466692_007567 | 3300042591 | Bacteria | 4316 |
| 3 | Ga0466692_029223 | 3300042591 | Bacteria | 8166 |
| 4 | Ga0466691_215870 | 3300042593 | Bacteria | 28022 |
| 5 | Ga0466711_409636 | 3300042615 | Bacteria | 2714 |
| 6 | Ga0466715_255231 | 3300042616 | Bacteria | 16098 |
| 7 | Ga0466723_026213 | 3300042618 | Bacteria | 14458 |
| 8 | Ga0466719_221864 | 3300042606 | Bacteria | 2740 |
| 9 | IMNBL1DRAFT_c0007870 | 3300000062 | Bacteria | 5524 |
| 10 | IMNBL1DRAFT_c0021583 | 3300000062 | Bacteria | 2573 |
| 11 | Ga0068305_10194288 | 3300005083 | Bacteria | 4561 |
| 12 | Ga0466725_225545 | 3300042654 | Bacteria | 19445 |
| 13 | Ga0466696_291331 | 3300042596 | Bacteria | 6734 |
| 14 | Ga0466711_217078 | 3300042615 | Bacteria | 7411 |
| 15 | Ga0466711_280901 | 3300042615 | Bacteria | 19639 |
| 16 | Ga0466715_026465 | 3300042616 | Bacteria | 99999 |
| 17 | Ga0466715_380145 | 3300042616 | Bacteria | 11285 |
| 18 | Ga0466707_105393 | 3300042601 | Bacteria | 9495 |
| 19 | Ga0466707_169356 | 3300042601 | Bacteria | 5977 |
| 20 | Ga0466707_184627 | 3300042601 | Bacteria | 3718 |
| 21 | Ga0466722_011067 | 3300042609 | Bacteria | 2637 |
| 22 | Ga0123354_10011453 | 3300010882 | Bacteria | 13707 |
| 23 | Ga0068305_10360953 | 3300005083 | Unclassified | 5744 |
| 24 | Ga0123357_10000612 | 3300009784 | Bacteria | 35430 |
| 25 | Ga0466735_065370 | 3300042624 | Bacteria | 13419 |
| 26 | Ga0466735_087178 | 3300042624 | Bacteria | 4194 |
| 27 | Ga0466703_186156 | 3300042636 | Bacteria | 12803 |
| 28 | Ga0466709_393874 | 3300042648 | Bacteria | 3843 |
| 29 | Ga0466705_285384 | 3300042612 | Bacteria | 16739 |
| 30 | Ga0466705_302081 | 3300042612 | Bacteria | 8183 |
| 31 | Ga0466696_154379 | 3300042596 | Bacteria | 2122 |
| 32 | Ga0466707_210624 | 3300042601 | Bacteria | 5312 |
| 33 | Ga0466713_011183 | 3300042602 | Bacteria | 6139 |
| 34 | Ga0466719_019865 | 3300042606 | Bacteria | 6113 |
| 35 | Ga0466722_228094 | 3300042609 | Bacteria | 6275 |
| 36 | Ga0123356_10103346 | 3300010049 | Bacteria | 2737 |
| 37 | IMNBL1DRAFT_c0000935 | 3300000062 | Bacteria | 22566 |
| 38 | JGI24699J35502_11134056 | 3300002509 | Bacteria | 27277 |
| 39 | Ga0466729_307898 | 3300042621 | Bacteria | 17594 |
| 40 | Ga0466735_066377 | 3300042624 | Bacteria | 4897 |
| 41 | Ga0466703_263547 | 3300042636 | Bacteria | 19799 |
| 42 | Ga0466704_395685 | 3300042643 | Bacteria | 5430 |
| 43 | Ga0466709_138567 | 3300042648 | Bacteria | 14536 |
| 44 | Ga0466727_080215 | 3300042655 | Bacteria | 8461 |
| 45 | Ga0466727_217290 | 3300042655 | Bacteria | 10505 |
| 46 | Ga0466705_086385 | 3300042612 | Bacteria | 6441 |
| 47 | Ga0466705_392662 | 3300042612 | Bacteria | 3093 |
| 48 | Ga0466715_182963 | 3300042616 | Bacteria | 8539 |
| 49 | Ga0466717_178946 | 3300042604 | Bacteria | 3065 |
| 50 | Ga0466698_229449 | 3300042610 | Bacteria | 2013 |
| 51 | Ga0123357_10010214 | 3300009784 | Bacteria | 11922 |
| 52 | 2227503798 | 2225789004 | Unclassified | 3736 |
| 53 | Ga0466704_117322 | 3300042643 | Bacteria | 8093 |
| 54 | Ga0466704_234531 | 3300042643 | Bacteria | 25098 |
| 55 | Ga0466708_145890 | 3300042652 | Bacteria | 28616 |
| 56 | Ga0466697_250686 | 3300042611 | Bacteria | 3839 |
| 57 | Ga0466733_121822 | 3300042659 | Bacteria | 48145 |
| 58 | Ga0466707_099704 | 3300042601 | Bacteria | 14474 |
| 59 | Ga0466713_011249 | 3300042602 | Bacteria | 73032 |
| 60 | Ga0466713_091714 | 3300042602 | Bacteria | 189911 |
| 61 | Ga0466716_362126 | 3300042605 | Bacteria | 14616 |
| 62 | Ga0466716_476877 | 3300042605 | Bacteria | 11922 |
| 63 | Ga0123357_10011589 | 3300009784 | Bacteria | 11318 |
| 64 | Ga0123357_10021889 | 3300009784 | Bacteria | 8563 |
| 65 | Ga0123353_10407738 | 3300010167 | Bacteria | 2020 |
| 66 | 2227641281 | 2225789004 | Bacteria | 11050 |
| 67 | JGI24699J35502_11133642 | 3300002509 | Bacteria | 12864 |
| 68 | JGI24699J35502_11134047 | 3300002509 | Bacteria | 26850 |
| 69 | JGI24696J40584_12954025 | 3300002834 | Bacteria | 2570 |
| 70 | Ga0068305_10020972 | 3300005083 | Bacteria | 3959 |
| 71 | Ga0123357_10000105 | 3300009784 | Bacteria | 69766 |
| 72 | Ga0466734_040793 | 3300042623 | Bacteria | 2199 |
| 73 | Ga0466735_116785 | 3300042624 | Bacteria | 3719 |
| 74 | Ga0466703_115996 | 3300042636 | Bacteria | 4974 |
| 75 | Ga0466703_282565 | 3300042636 | Bacteria | 9306 |
| 76 | Ga0466704_235911 | 3300042643 | Bacteria | 3813 |
| 77 | Ga0466725_083753 | 3300042654 | Bacteria | 27078 |
| 78 | Ga0466727_078549 | 3300042655 | Bacteria | 18273 |
| 79 | Ga0466727_167815 | 3300042655 | Bacteria | 9812 |
| 80 | Ga0466727_313462 | 3300042655 | Bacteria | 28907 |
| 81 | Ga0466705_120499 | 3300042612 | Bacteria | 7279 |
| 82 | Ga0466733_066373 | 3300042659 | Bacteria | 26399 |
| 83 | Ga0466696_454722 | 3300042596 | Bacteria | 41485 |
| 84 | Ga0466711_093162 | 3300042615 | Bacteria | 19638 |
| 85 | Ga0466715_012002 | 3300042616 | Bacteria | 9704 |
| 86 | Ga0466701_038865 | 3300042598 | Bacteria | 42316 |
| 87 | Ga0466716_406042 | 3300042605 | Bacteria | 10247 |
| 88 | Ga0466722_048054 | 3300042609 | Bacteria | 48867 |
| 89 | Ga0466722_056895 | 3300042609 | Bacteria | 32920 |
| 90 | Ga0466698_447568 | 3300042610 | Bacteria | 5023 |
| 91 | Ga0123357_10065276 | 3300009784 | Bacteria | 4860 |
| 92 | Ga0123356_10107488 | 3300010049 | Bacteria | 2688 |
| 93 | IMNBL1DRAFT_c0005099 | 3300000062 | Bacteria | 7636 |
| 94 | JGI24705J35276_12236296 | 3300002504 | Bacteria | 7790 |
| 95 | Ga0123357_10000887 | 3300009784 | Bacteria | 30512 |
| 96 | Ga0466735_086920 | 3300042624 | Bacteria | 5165 |
| 97 | Ga0466704_531319 | 3300042643 | Bacteria | 12457 |
| 98 | Ga0466697_174790 | 3300042611 | Bacteria | 1686 |
| 99 | Ga0466733_002151 | 3300042659 | Bacteria | 71476 |
| 100 | Ga0415639_223062 | 3300038395 | Bacteria | 1395 |
| 101 | Ga0466694_068038 | 3300042594 | Bacteria | 2362 |
| 102 | Ga0466696_124654 | 3300042596 | Bacteria | 8786 |
| 103 | Ga0466723_273875 | 3300042618 | Bacteria | 3811 |
| 104 | Ga0466713_107644 | 3300042602 | Bacteria | 8490 |
| 105 | Ga0466719_058599 | 3300042606 | Unclassified | 3444 |
| 106 | Ga0466719_378735 | 3300042606 | Bacteria | 28336 |
| 107 | Ga0466719_520065 | 3300042606 | Bacteria | 11153 |
| 108 | Ga0466722_084309 | 3300042609 | Bacteria | 46740 |
| 109 | Ga0466722_105168 | 3300042609 | Bacteria | 17047 |
| 110 | Ga0123354_10002823 | 3300010882 | Bacteria | 23443 |
| 111 | JGI24702J35022_10000503 | 3300002462 | Bacteria | 23633 |
| 112 | Ga0068302_10073055 | 3300005071 | Bacteria | 2248 |
| 113 | Ga0466735_113150 | 3300042624 | Bacteria | 4169 |
| 114 | Ga0466703_258794 | 3300042636 | Bacteria | 7278 |
| 115 | Ga0466704_592967 | 3300042643 | Bacteria | 4540 |
| 116 | Ga0466727_192706 | 3300042655 | Bacteria | 6250 |
| 117 | Ga0466727_315449 | 3300042655 | Bacteria | 7913 |
| 118 | Ga0466705_017759 | 3300042612 | Bacteria | 4562 |
| 119 | Ga0466733_013278 | 3300042659 | Bacteria | 16437 |
| 120 | Ga0466690_001973 | 3300042590 | Bacteria | 16119 |
| 121 | Ga0466692_029964 | 3300042591 | Bacteria | 2610 |
| 122 | Ga0466691_214266 | 3300042593 | Bacteria | 3621 |
| 123 | Ga0466711_337599 | 3300042615 | Bacteria | 7802 |
| 124 | Ga0466715_109224 | 3300042616 | Bacteria | 75833 |
| 125 | Ga0466718_016528 | 3300042617 | Bacteria | 3148 |
| 126 | Ga0466726_016918 | 3300042619 | Bacteria | 8175 |
| 127 | Ga0466726_074420 | 3300042619 | Bacteria | 3340 |
| 128 | Ga0466701_088409 | 3300042598 | Bacteria | 49099 |
| 129 | Ga0466706_143380 | 3300042599 | Bacteria | 33599 |
| 130 | Ga0466700_402067 | 3300042600 | Unclassified | 2845 |
| 131 | Ga0466707_416587 | 3300042601 | Bacteria | 30414 |
| 132 | Ga0123354_10009067 | 3300010882 | Bacteria | 15188 |
| 133 | IMNBL1DRAFT_c0001689 | 3300000062 | Bacteria | 16277 |
| 134 | Ga0068302_10055686 | 3300005071 | Bacteria | 2844 |
| 135 | Ga0466703_431524 | 3300042636 | Bacteria | 2188 |
| 136 | Ga0466704_200046 | 3300042643 | Bacteria | 8189 |
| 137 | Ga0466708_056189 | 3300042652 | Bacteria | 10244 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00474 | SSF | Sodium:solute symporter family | 86 | 477 | 0.8 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.