Protein Family IF07162
Metagenome
Metatranscriptome
Isolate
142
Members
44
Samples
137
Scaffolds
312.88
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_251788|Ga0466705_251788_153_1193
- Length
- 346 aa
- Sequence
- MHDRNGDRSNQKRIALEYWTPLRINWYAKERIDMPYKPVPQTFTASIREVVVGAGEKALTLGGENIFPLYCFDAPLKNPPRVGVEISDAGPDRNIPGVAAFYAGAETVADAAKRACHMPGADFICLTLESADPNGANVPVEDCAALCGEVAGAVTLPLVIQGCKNIEKDGKLFEKIAEVLQGKNTLLLSAREENYKAVAAAAVLAYGQKIGAESAVDINLAKQLNVLISQLGVAAGNTVMNVGAAAAGYGFEYVASTMDRVRGAALAQNDAMLQMPVITPVSAEAWGVKESVVPEEDLPEWGPLEERGIRMEIVTAAAALAAGSNAVILRHPASVAAISQFISDLL
Sample Types
Isolate
3.5%
Metagenome
95.8%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.9%
Kalotermitidae
32.6%
Unclassified
16.3%
Rhinotermitidae
9.3%
Termopsidae
7.0%
Taxonomy
Archaea
3
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 2 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 13 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 14 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 15 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 16 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 17 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 27 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 40 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 41 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_333914 | 3300042601 | Bacteria | 3965 |
| 2 | Ga0123357_10322857 | 3300009784 | Bacteria | 1522 |
| 3 | Ga0466711_234862 | 3300042615 | Bacteria | 8961 |
| 4 | Ga0466711_317155 | 3300042615 | Bacteria | 4219 |
| 5 | Ga0466715_065256 | 3300042616 | Bacteria | 1908 |
| 6 | Ga0466715_498751 | 3300042616 | Bacteria | 4280 |
| 7 | Ga0466723_074624 | 3300042618 | Archaea | 15883 |
| 8 | Ga0466726_018928 | 3300042619 | Bacteria | 2986 |
| 9 | Ga0466728_433053 | 3300042620 | Bacteria | 10296 |
| 10 | Ga0466729_123218 | 3300042621 | Bacteria | 2343 |
| 11 | Ga0466692_137744 | 3300042591 | Bacteria | 2317 |
| 12 | Ga0466699_053014 | 3300042597 | Bacteria | 15726 |
| 13 | Ga0466697_061443 | 3300042611 | Bacteria | 2758 |
| 14 | Ga0466705_205234 | 3300042612 | Bacteria | 13293 |
| 15 | Ga0466705_354513 | 3300042612 | Bacteria | 8075 |
| 16 | Ga0466731_049748 | 3300042622 | Bacteria | 4620 |
| 17 | Ga0466702_416727 | 3300042635 | Bacteria | 2318 |
| 18 | Ga0466704_130788 | 3300042643 | Bacteria | 6689 |
| 19 | Ga0466704_237376 | 3300042643 | Bacteria | 9329 |
| 20 | Ga0466709_064273 | 3300042648 | Bacteria | 18619 |
| 21 | Ga0466708_017370 | 3300042652 | Bacteria | 1608 |
| 22 | Ga0466708_114698 | 3300042652 | Bacteria | 15315 |
| 23 | Ga0123355_10002159 | 3300009826 | Bacteria | 27759 |
| 24 | Ga0466711_143067 | 3300042615 | Bacteria | 38768 |
| 25 | Ga0466715_096853 | 3300042616 | Bacteria | 12428 |
| 26 | Ga0466715_587947 | 3300042616 | Bacteria | 13104 |
| 27 | Ga0466723_090247 | 3300042618 | Bacteria | 25495 |
| 28 | Ga0466723_107197 | 3300042618 | Bacteria | 3964 |
| 29 | Ga0466726_371233 | 3300042619 | Bacteria | 3673 |
| 30 | Ga0466690_060087 | 3300042590 | Bacteria | 9012 |
| 31 | Ga0466696_013382 | 3300042596 | Bacteria | 35562 |
| 32 | Ga0466696_180436 | 3300042596 | Bacteria | 7429 |
| 33 | Ga0466708_337145 | 3300042652 | Bacteria | 1627 |
| 34 | Ga0466707_187326 | 3300042601 | Bacteria | 1516 |
| 35 | Ga0466707_339725 | 3300042601 | Bacteria | 15844 |
| 36 | Ga0466716_006654 | 3300042605 | Bacteria | 4453 |
| 37 | Ga0466719_088309 | 3300042606 | Bacteria | 60348 |
| 38 | Ga0466719_235861 | 3300042606 | Bacteria | 8202 |
| 39 | Ga0466720_089269 | 3300042607 | Bacteria | 2394 |
| 40 | Ga0466720_182641 | 3300042607 | Bacteria | 2113 |
| 41 | Ga0466722_034222 | 3300042609 | Bacteria | 13072 |
| 42 | Ga0466722_044203 | 3300042609 | Unclassified | 1546 |
| 43 | Ga0466722_068354 | 3300042609 | Unclassified | 1499 |
| 44 | Ga0123357_10129899 | 3300009784 | Archaea | 3141 |
| 45 | Ga0123356_10002840 | 3300010049 | Bacteria | 18334 |
| 46 | Ga0466723_171581 | 3300042618 | Unclassified | 6398 |
| 47 | Ga0466723_246254 | 3300042618 | Bacteria | 5847 |
| 48 | Ga0466726_011192 | 3300042619 | Unclassified | 1443 |
| 49 | Ga0466726_076377 | 3300042619 | Bacteria | 10215 |
| 50 | Ga0466728_162428 | 3300042620 | Unclassified | 1687 |
| 51 | Ga0466690_098437 | 3300042590 | Bacteria | 5687 |
| 52 | Ga0466691_063715 | 3300042593 | Bacteria | 17528 |
| 53 | Ga0466691_097978 | 3300042593 | Bacteria | 18881 |
| 54 | Ga0072941_1014853 | 3300005201 | Unclassified | 4761 |
| 55 | Ga0466705_036392 | 3300042612 | Bacteria | 23320 |
| 56 | Ga0466703_069324 | 3300042636 | Bacteria | 15430 |
| 57 | Ga0466708_086897 | 3300042652 | Bacteria | 18459 |
| 58 | Ga0466708_166190 | 3300042652 | Bacteria | 10252 |
| 59 | Ga0466727_288787 | 3300042655 | Bacteria | 2009 |
| 60 | Ga0466707_374383 | 3300042601 | Bacteria | 2512 |
| 61 | Ga0466707_421230 | 3300042601 | Bacteria | 7887 |
| 62 | Ga0466716_135191 | 3300042605 | Unclassified | 1940 |
| 63 | Ga0466716_184762 | 3300042605 | Unclassified | 1683 |
| 64 | Ga0466719_056207 | 3300042606 | Bacteria | 8286 |
| 65 | Ga0466719_086308 | 3300042606 | Bacteria | 21064 |
| 66 | Ga0466719_545144 | 3300042606 | Bacteria | 4986 |
| 67 | Ga0466722_023990 | 3300042609 | Bacteria | 14966 |
| 68 | Ga0466722_040583 | 3300042609 | Bacteria | 11177 |
| 69 | Ga0466711_137264 | 3300042615 | Bacteria | 1763 |
| 70 | Ga0466723_188690 | 3300042618 | Bacteria | 9317 |
| 71 | Ga0466723_278876 | 3300042618 | Bacteria | 6216 |
| 72 | Ga0466726_078253 | 3300042619 | Unclassified | 1296 |
| 73 | Ga0456237_0012054 | 3300041968 | Bacteria | 1255 |
| 74 | Ga0466690_220437 | 3300042590 | Bacteria | 8212 |
| 75 | Ga0466699_292514 | 3300042597 | Bacteria | 9037 |
| 76 | Ga0466705_037999 | 3300042612 | Bacteria | 2964 |
| 77 | Ga0466705_189482 | 3300042612 | Bacteria | 6998 |
| 78 | Ga0466703_119556 | 3300042636 | Bacteria | 2723 |
| 79 | Ga0466703_271927 | 3300042636 | Bacteria | 9639 |
| 80 | Ga0466703_345754 | 3300042636 | Bacteria | 5152 |
| 81 | Ga0466727_048799 | 3300042655 | Unclassified | 1520 |
| 82 | Ga0466707_106053 | 3300042601 | Bacteria | 1418 |
| 83 | Ga0466707_219615 | 3300042601 | Bacteria | 24045 |
| 84 | Ga0466711_091584 | 3300042615 | Bacteria | 27785 |
| 85 | Ga0466711_183125 | 3300042615 | Bacteria | 11078 |
| 86 | Ga0466711_221526 | 3300042615 | Bacteria | 17842 |
| 87 | Ga0466711_239252 | 3300042615 | Bacteria | 3475 |
| 88 | Ga0466711_362814 | 3300042615 | Bacteria | 2063 |
| 89 | Ga0466726_036084 | 3300042619 | Bacteria | 2642 |
| 90 | Ga0466726_338181 | 3300042619 | Archaea | 1174 |
| 91 | Ga0466726_346767 | 3300042619 | Bacteria | 10747 |
| 92 | Ga0466728_187901 | 3300042620 | Bacteria | 16781 |
| 93 | Ga0466728_226419 | 3300042620 | Bacteria | 23226 |
| 94 | Ga0466705_059593 | 3300042612 | Bacteria | 20770 |
| 95 | Ga0466705_251788 | 3300042612 | Bacteria | 6358 |
| 96 | Ga0466702_192246 | 3300042635 | Unclassified | 1685 |
| 97 | Ga0466709_106907 | 3300042648 | Bacteria | 5513 |
| 98 | Ga0466700_104273 | 3300042600 | Bacteria | 4873 |
| 99 | Ga0466719_291826 | 3300042606 | Bacteria | 2117 |
| 100 | Ga0123356_10611825 | 3300010049 | Bacteria | 1255 |
| 101 | Ga0123353_10051182 | 3300010167 | Bacteria | 6590 |
| 102 | Ga0466711_229784 | 3300042615 | Bacteria | 2880 |
| 103 | Ga0466715_514839 | 3300042616 | Bacteria | 13253 |
| 104 | Ga0466723_017451 | 3300042618 | Bacteria | 1454 |
| 105 | Ga0466723_220176 | 3300042618 | Bacteria | 7448 |
| 106 | Ga0466726_152254 | 3300042619 | Bacteria | 2809 |
| 107 | Ga0466690_155140 | 3300042590 | Bacteria | 3444 |
| 108 | Ga0466691_047632 | 3300042593 | Bacteria | 15841 |
| 109 | Ga0068302_10269031 | 3300005071 | Bacteria | 1766 |
| 110 | Ga0068305_10475574 | 3300005083 | Bacteria | 3939 |
| 111 | Ga0466707_104275 | 3300042601 | Bacteria | 51325 |
| 112 | Ga0466722_100675 | 3300042609 | Bacteria | 12542 |
| 113 | Ga0466722_230497 | 3300042609 | Bacteria | 21575 |
| 114 | Ga0123353_10436382 | 3300010167 | Bacteria | 1934 |
| 115 | Ga0466728_309787 | 3300042620 | Bacteria | 1874 |
| 116 | Ga0466690_002418 | 3300042590 | Bacteria | 8394 |
| 117 | Ga0068305_10342605 | 3300005083 | Bacteria | 1705 |
| 118 | Ga0466702_167767 | 3300042635 | Bacteria | 2285 |
| 119 | Ga0466732_435430 | 3300042656 | Bacteria | 2991 |
| 120 | Ga0466713_117047 | 3300042602 | Bacteria | 144191 |
| 121 | Ga0466722_158487 | 3300042609 | Bacteria | 1300 |
| 122 | Ga0466705_439343 | 3300042612 | Bacteria | 236994 |
| 123 | Ga0466712_028930 | 3300042614 | Bacteria | 1640 |
| 124 | Ga0466723_028374 | 3300042618 | Bacteria | 7945 |
| 125 | Ga0466726_054791 | 3300042619 | Bacteria | 5982 |
| 126 | Ga0466726_068419 | 3300042619 | Bacteria | 2630 |
| 127 | Ga0466728_235834 | 3300042620 | Bacteria | 17793 |
| 128 | Ga0255786_1017034 | 3300022815 | Bacteria | 1948 |
| 129 | Ga0466692_046984 | 3300042591 | Bacteria | 3102 |
| 130 | Ga0466696_236797 | 3300042596 | Bacteria | 7355 |
| 131 | JGI24702J35022_10004635 | 3300002462 | Bacteria | 8139 |
| 132 | Ga0068305_10011964 | 3300005083 | Bacteria | 124405 |
| 133 | Ga0068305_10023433 | 3300005083 | Bacteria | 2472 |
| 134 | Ga0072941_1014852 | 3300005201 | Bacteria | 5698 |
| 135 | Ga0466703_076231 | 3300042636 | Bacteria | 23285 |
| 136 | Ga0466704_421201 | 3300042643 | Bacteria | 1877 |
| 137 | Ga0466708_185370 | 3300042652 | Bacteria | 8078 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03599 | CdhD | CO dehydrogenase/acetyl-CoA synthase delta subunit | 49 | 290 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.