Protein Family IF07105

Metagenome Isolate
165 Members
62 Samples
148 Scaffolds
254.65 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_125368|Ga0466705_125368_3941_4888
Length
295 aa
Sequence
VERTGVVRDGETASAEGAPNGGASQDTRPAPRKAFIAFVTGGDPSLEHSERYIRALVEGGADLIEIGVPFSDPIAEGPVIQEANLRALAAGTTLDGIFELVRSLRRGGGVQTQARSLRQEAPLQIPIVLLTYLNPVHHYGYQAFFATCAEAGVDGIIIPDLPYDEKDELADVAAANGVDIISLIAPTSAERITTIATDATGYIYLVSSMGVTGVRSEITTDLAAMVALIRAGTDTPIAVGFGIHTPEQARAIIQEANADGAIVGSAIVRMIAADPEGAPATLAAYAHTMKAAMEG

📊 Sample Types

Isolate 10.3%
Metagenome 89.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.0%
Unclassified 30.5%
Kalotermitidae 23.7%
Termopsidae 5.1%
Rhinotermitidae 1.7%

🌳 Taxonomy

Archaea 2
Bacteria 152
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820364642 Unclassified Firmicutes Nt197P3bin107 Isolate Unclassified
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
4 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
5 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
10 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
11 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
12 2820093073 Unclassified Proteobacteria Lab288P3bin233 Isolate Unclassified
13 2820327087 Unclassified Firmicutes Nt197P3bin79 Isolate Unclassified
14 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
15 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
16 2773857681 Unclassified Methanomassiliicoccaceae Lab288P1bin114 Isolate Unclassified
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
19 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
26 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
29 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
30 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
33 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
36 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
37 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
38 2820688768 Unclassified Firmicutes Co191P1bin74 Isolate Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
41 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
42 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
43 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
44 2820082748 Unclassified Proteobacteria Lab288P4bin14 Isolate Unclassified
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
51 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
52 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
53 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
54 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
55 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
56 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
57 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
58 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
59 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
60 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
61 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
62 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_125368 3300042612 Bacteria 5158
2 Ga0466723_198328 3300042618 Bacteria 15765
3 Ga0466726_317642 3300042619 Unclassified 1386
4 JGI24695J34938_10001486 3300002450 Bacteria 19789
5 JGI24695J34938_10014104 3300002450 Unclassified 4161
6 Ga0123357_10072631 3300009784 Bacteria 4558
7 Ga0123355_10488751 3300009826 Bacteria 1526
8 Ga0123355_10620603 3300009826 Unclassified 1274
9 Ga0123355_10790916 3300009826 Unclassified 1061
10 Ga0123356_10026741 3300010049 Bacteria 5414
11 Ga0123354_10153598 3300010882 Bacteria 2774
12 Ga0466703_234052 3300042636 Bacteria 1470
13 Ga0466703_419255 3300042636 Bacteria 14673
14 Ga0466713_005593 3300042602 Bacteria 8314
15 Ga0466717_130261 3300042604 Bacteria 1801
16 Ga0466716_131977 3300042605 Bacteria 1414
17 Ga0466716_200887 3300042605 Bacteria 20455
18 Ga0466720_174305 3300042607 Bacteria 17090
19 Ga0466722_218877 3300042609 Bacteria 3910
20 Ga0466697_069862 3300042611 Unclassified 1145
21 Ga0466705_405779 3300042612 Bacteria 9421
22 Ga0466723_125622 3300042618 Bacteria 12746
23 Ga0466726_109379 3300042619 Bacteria 27937
24 Ga0415639_099910 3300038395 Bacteria 2511
25 Ga0466657_317026 3300042582 Bacteria 10683
26 JGI24698J34947_10009636 3300002449 Bacteria 5293
27 JGI24695J34938_10000307 3300002450 Bacteria 48159
28 Ga0123357_10461782 3300009784 Bacteria 1091
29 Ga0123356_10000609 3300010049 Bacteria 39509
30 Ga0123356_10048856 3300010049 Bacteria 3937
31 Ga0123353_10167940 3300010167 Bacteria 3486
32 Ga0123353_10375189 3300010167 Bacteria 2130
33 Ga0123353_10631282 3300010167 Bacteria 1522
34 Ga0123353_11589043 3300010167 Unclassified 827
35 Ga0123353_11617772 3300010167 Unclassified 817
36 Ga0466731_121404 3300042622 Bacteria 1251
37 Ga0466703_003860 3300042636 Bacteria 5403
38 Ga0466716_051309 3300042605 Archaea 7311
39 Ga0466719_486152 3300042606 Bacteria 2544
40 Ga0466721_230472 3300042608 Bacteria 2129
41 Ga0466722_268941 3300042609 Bacteria 1702
42 Ga0466733_148495 3300042659 Bacteria 3370
43 Ga0466715_173730 3300042616 Bacteria 14565
44 Ga0466718_042183 3300042617 Bacteria 62729
45 Ga0466718_102338 3300042617 Bacteria 1201
46 Ga0466728_366681 3300042620 Bacteria 30769
47 Ga0466690_160212 3300042590 Bacteria 28464
48 Ga0466690_251322 3300042590 Bacteria 19231
49 Ga0466693_054771 3300042592 Bacteria 1904
50 Ga0466694_040445 3300042594 Bacteria 8158
51 Ga0466696_170739 3300042596 Bacteria 13902
52 Ga0466696_432422 3300042596 Bacteria 5986
53 JGI24695J34938_10005574 3300002450 Bacteria 7806
54 JGI24695J34938_10111964 3300002450 Unclassified 1112
55 Ga0072941_1208886 3300005201 Bacteria 2243
56 Ga0123355_10125280 3300009826 Bacteria 3972
57 Ga0123353_10196292 3300010167 Bacteria 3181
58 Ga0466702_040608 3300042635 Bacteria 2182
59 Ga0466703_167798 3300042636 Bacteria 14537
60 Ga0466727_137467 3300042655 Bacteria 7954
61 Ga0466714_001055 3300042603 Bacteria 4994
62 Ga0466705_278240 3300042612 Bacteria 34444
63 Ga0466711_149344 3300042615 Bacteria 10217
64 Ga0466726_104810 3300042619 Bacteria 4668
65 Ga0466728_133863 3300042620 Bacteria 6789
66 Ga0466693_110507 3300042592 Bacteria 60686
67 JGI24695J34938_10013919 3300002450 Unclassified 4200
68 JGI24695J34938_10031017 3300002450 Bacteria 2484
69 Ga0074263_109376 3300005485 Bacteria 2098
70 Ga0123356_10003881 3300010049 Bacteria 15567
71 Ga0466704_127982 3300042643 Bacteria 28123
72 Ga0466708_315395 3300042652 Bacteria 4465
73 Ga0466727_097807 3300042655 Bacteria 2231
74 Ga0466727_259387 3300042655 Bacteria 3654
75 Ga0466719_088067 3300042606 Bacteria 1554
76 Ga0466720_168007 3300042607 Bacteria 17712
77 Ga0466697_019042 3300042611 Bacteria 1242
78 Ga0466715_038331 3300042616 Bacteria 17821
79 Ga0466723_066635 3300042618 Bacteria 8230
80 Ga0466726_116378 3300042619 Bacteria 6788
81 Ga0466728_079241 3300042620 Bacteria 4789
82 Ga0415639_113639 3300038395 Bacteria 3213
83 Ga0466691_080256 3300042593 Bacteria 12723
84 Ga0466694_215213 3300042594 Bacteria 2293
85 Ga0123353_10238792 3300010167 Bacteria 2826
86 Ga0123353_10334978 3300010167 Bacteria 2288
87 Ga0123353_10496199 3300010167 Bacteria 1780
88 Ga0123354_10250691 3300010882 Bacteria 1794
89 Ga0466731_204500 3300042622 Bacteria 7383
90 Ga0466702_224892 3300042635 Bacteria 1262
91 Ga0466703_142515 3300042636 Bacteria 13214
92 Ga0466720_142847 3300042607 Bacteria 3920
93 Ga0466705_077241 3300042612 Bacteria 5369
94 Ga0466718_040185 3300042617 Unclassified 8422
95 Ga0466728_325091 3300042620 Bacteria 3870
96 Ga0264413_102908 3300024493 Bacteria 10528
97 Ga0415639_087191 3300038395 Bacteria 8352
98 JGI24698J34947_10018993 3300002449 Bacteria 3712
99 JGI24695J34938_10021009 3300002450 Bacteria 3203
100 Ga0123356_10000004 3300010049 Bacteria 279505
101 Ga0123353_10108935 3300010167 Bacteria 4463
102 Ga0466731_350720 3300042622 Bacteria 2485
103 Ga0466703_223867 3300042636 Bacteria 1631
104 Ga0466704_157888 3300042643 Bacteria 14402
105 Ga0466709_289895 3300042648 Bacteria 1537
106 Ga0466727_245486 3300042655 Bacteria 6111
107 Ga0466714_024663 3300042603 Bacteria 9920
108 Ga0466719_110851 3300042606 Bacteria 7005
109 Ga0466705_207397 3300042612 Bacteria 9263
110 Ga0466733_002192 3300042659 Bacteria 2945
111 Ga0466723_230603 3300042618 Bacteria 14656
112 Ga0466726_455568 3300042619 Bacteria 15333
113 Ga0466728_355582 3300042620 Bacteria 19335
114 Ga0466690_004676 3300042590 Bacteria 3271
115 Ga0466693_237066 3300042592 Bacteria 4462
116 JGI24698J34947_10017879 3300002449 Bacteria 3839
117 Ga0123355_10150016 3300009826 Bacteria 3544
118 Ga0123353_10000244 3300010167 Bacteria 68042
119 Ga0123354_10134002 3300010882 Bacteria 3110
120 Ga0466702_028506 3300042635 Bacteria 2773
121 Ga0466702_114240 3300042635 Bacteria 3514
122 Ga0466704_294216 3300042643 Bacteria 2537
123 Ga0466725_373717 3300042654 Bacteria 21411
124 Ga0466714_004093 3300042603 Bacteria 2241
125 Ga0466717_185963 3300042604 Bacteria 1662
126 Ga0466718_109405 3300042617 Bacteria 17846
127 Ga0466723_181743 3300042618 Bacteria 4494
128 Ga0265387_1002380 3300024582 Bacteria 2657
129 Ga0466690_282464 3300042590 Bacteria 3431
130 Ga0466694_092283 3300042594 Bacteria 41988
131 Ga0466696_118125 3300042596 Bacteria 22206
132 Ga0466699_153191 3300042597 Bacteria 1324
133 Ga0068302_10000063 3300005071 Unclassified 6593
134 Ga0068302_10106977 3300005071 Bacteria 2401
135 Ga0123355_10006074 3300009826 Bacteria 17806
136 Ga0123355_10319783 3300009826 Bacteria 2093
137 Ga0123353_10126399 3300010167 Bacteria 4109
138 Ga0123353_10229375 3300010167 Bacteria 2897
139 Ga0123353_10366424 3300010167 Bacteria 2163
140 Ga0123353_10380581 3300010167 Bacteria 2111
141 Ga0466702_229430 3300042635 Bacteria 14596
142 Ga0466704_422642 3300042643 Bacteria 6099
143 Ga0466708_309870 3300042652 Bacteria 56294
144 Ga0466714_051475 3300042603 Bacteria 1129
145 Ga0466716_459223 3300042605 Bacteria 1149
146 Ga0466719_445851 3300042606 Bacteria 2346
147 Ga0466722_008134 3300042609 Bacteria 5921
148 Ga0466722_130920 3300042609 Bacteria 11261

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042622 Ga0466731_121404 Ga0466731_121404_489_1136 215
2 3300042636 Ga0466703_234052 Ga0466703_234052_664_1392 215
3 3300009826 Ga0123355_10620603 Ga0123355_106206032 221
4 3300042604 Ga0466717_185963 Ga0466717_185963_306_1022 238
5 iso_pr_bacteria 2820364642 2820364976 238
6 iso_pr_bacteria 2820688768 2820690000 238
7 3300009826 Ga0123355_10319783 Ga0123355_103197832 239
8 3300010167 Ga0123353_10126399 Ga0123353_101263994 239
9 3300010167 Ga0123353_10229375 Ga0123353_102293752 239
10 3300010167 Ga0123353_10380581 Ga0123353_103805812 239
11 3300010167 Ga0123353_10631282 Ga0123353_106312822 239
12 3300010882 Ga0123354_10250691 Ga0123354_102506912 239
13 3300038395 Ga0415639_087191 Ga0415639_087191_3644_4363 239
14 3300038395 Ga0415639_099910 Ga0415639_099910_656_1375 239
15 iso_pu_archaea 2773857681 2774153882 239
16 3300010167 Ga0123353_11589043 Ga0123353_115890432 240
17 3300009826 Ga0123355_10006074 Ga0123355_1000607413 241
18 3300009826 Ga0123355_10125280 Ga0123355_101252805 241
19 3300038395 Ga0415639_113639 Ga0415639_113639_1753_2478 241
20 3300042582 Ga0466657_317026 Ga0466657_317026_1248_1973 241
21 3300042611 Ga0466697_019042 Ga0466697_019042_83_808 241
22 3300042612 Ga0466705_207397 Ga0466705_207397_2698_3423 241
23 3300042622 Ga0466731_350720 Ga0466731_350720_1726_2451 241
24 iso_pr_bacteria 2820250282 2820251426 241
25 iso_pr_bacteria 2820327087 2820327514 241
26 3300009784 Ga0123357_10072631 Ga0123357_100726313 242
27 3300009784 Ga0123357_10461782 Ga0123357_104617822 242
28 3300010167 Ga0123353_10108935 Ga0123353_101089353 242
29 3300010167 Ga0123353_10167940 Ga0123353_101679403 242
30 3300010167 Ga0123353_10196292 Ga0123353_101962922 242
31 3300010167 Ga0123353_10238792 Ga0123353_102387922 242
32 3300010167 Ga0123353_10334978 Ga0123353_103349782 242
33 3300010167 Ga0123353_10366424 Ga0123353_103664242 242
34 3300010167 Ga0123353_10375189 Ga0123353_103751894 242
35 3300010167 Ga0123353_10496199 Ga0123353_104961992 242
36 3300010167 Ga0123353_11617772 Ga0123353_116177721 242
37 3300010882 Ga0123354_10134002 Ga0123354_101340022 242
38 3300010882 Ga0123354_10153598 Ga0123354_101535982 242
39 3300042654 Ga0466725_373717 Ga0466725_373717_18168_18896 242
40 3300009826 Ga0123355_10488751 Ga0123355_104887512 243
41 3300009826 Ga0123355_10790916 Ga0123355_107909162 243
42 3300042611 Ga0466697_069862 Ga0466697_069862_91_822 243
43 3300042603 Ga0466714_001055 Ga0466714_001055_58_792 244
44 3300042620 Ga0466728_079241 Ga0466728_079241_1778_2512 244
45 iso_pr_bacteria 2820082748 2820083846 245
46 iso_pr_bacteria 2820093073 2820093931 245
47 3300010167 Ga0123353_10000244 Ga0123353_1000024444 246
48 3300042590 Ga0466690_282464 Ga0466690_282464_706_1527 246
49 3300042606 Ga0466719_110851 Ga0466719_110851_6111_6899 248
50 iso_pr_bacteria 2820294436 2820296623 249
51 3300042605 Ga0466716_131977 Ga0466716_131977_307_1200 252
52 3300042612 Ga0466705_405779 Ga0466705_405779_1779_2687 253
53 3300042597 Ga0466699_153191 Ga0466699_153191_488_1255 255
54 3300042616 Ga0466715_038331 Ga0466715_038331_3853_4620 255
55 iso_pr_bacteria 2820570671 2820570815 255
56 3300010049 Ga0123356_10000004 Ga0123356_10000004144 256
57 3300024493 Ga0264413_102908 Ga0264413_1029089 256
58 3300024582 Ga0265387_1002380 Ga0265387_10023802 256
59 3300042592 Ga0466693_237066 Ga0466693_237066_1309_2079 256
60 3300042607 Ga0466720_168007 Ga0466720_168007_5264_6034 256
61 3300042607 Ga0466720_174305 Ga0466720_174305_6804_7574 256
62 3300042617 Ga0466718_042183 Ga0466718_042183_12182_12952 256
63 3300042619 Ga0466726_116378 Ga0466726_116378_4208_4978 256
64 3300042622 Ga0466731_204500 Ga0466731_204500_3931_4701 256
65 3300042635 Ga0466702_028506 Ga0466702_028506_640_1410 256
66 iso_pr_bacteria 2781125637 2781282272 256
67 iso_pr_bacteria 2781125646 2781301465 256
68 iso_pr_bacteria 2781125649 2781307656 256
69 iso_pr_bacteria 2781125665 2781342039 256
70 iso_pr_bacteria 2781125692 2781430534 256
71 3300002449 JGI24698J34947_10018993 JGI24698J34947_100189933 257
72 3300002450 JGI24695J34938_10000307 JGI24695J34938_100003077 257
73 3300002450 JGI24695J34938_10005574 JGI24695J34938_1000557410 257
74 3300002450 JGI24695J34938_10013919 JGI24695J34938_100139193 257
75 3300002450 JGI24695J34938_10014104 JGI24695J34938_100141043 257
76 3300002450 JGI24695J34938_10021009 JGI24695J34938_100210091 257
77 3300002450 JGI24695J34938_10111964 JGI24695J34938_101119641 257
78 3300005071 Ga0068302_10000063 Ga0068302_100000636 257
79 3300005071 Ga0068302_10106977 Ga0068302_101069772 257
80 3300005201 Ga0072941_1208886 Ga0072941_12088862 257
81 3300010049 Ga0123356_10000609 Ga0123356_1000060929 257
82 3300010049 Ga0123356_10003881 Ga0123356_1000388114 257
83 3300042602 Ga0466713_005593 Ga0466713_005593_2854_3627 257
84 3300042603 Ga0466714_024663 Ga0466714_024663_4237_5010 257
85 3300042603 Ga0466714_051475 Ga0466714_051475_160_933 257
86 3300042605 Ga0466716_051309 Ga0466716_051309_2078_2851 257
87 3300042609 Ga0466722_130920 Ga0466722_130920_6364_7137 257
88 3300042636 Ga0466703_419255 Ga0466703_419255_12279_13052 257
89 3300042643 Ga0466704_157888 Ga0466704_157888_9031_9804 257
90 3300042655 Ga0466727_137467 Ga0466727_137467_480_1253 257
91 3300042655 Ga0466727_259387 Ga0466727_259387_338_1111 257
92 3300042590 Ga0466690_004676 Ga0466690_004676_1327_2103 258
93 3300042590 Ga0466690_160212 Ga0466690_160212_15235_16011 258
94 3300042593 Ga0466691_080256 Ga0466691_080256_10103_10879 258
95 3300042596 Ga0466696_432422 Ga0466696_432422_848_1624 258
96 3300042605 Ga0466716_459223 Ga0466716_459223_186_962 258
97 3300042609 Ga0466722_218877 Ga0466722_218877_2449_3225 258
98 3300042612 Ga0466705_077241 Ga0466705_077241_1485_2261 258
99 3300042616 Ga0466715_173730 Ga0466715_173730_13267_14043 258
100 3300042617 Ga0466718_040185 Ga0466718_040185_7352_8128 258
101 3300042618 Ga0466723_066635 Ga0466723_066635_6776_7552 258
102 3300042618 Ga0466723_198328 Ga0466723_198328_8830_9606 258
103 3300042618 Ga0466723_230603 Ga0466723_230603_10993_11769 258
104 3300042619 Ga0466726_455568 Ga0466726_455568_7853_8629 258
105 3300042620 Ga0466728_355582 Ga0466728_355582_3434_4210 258
106 3300042636 Ga0466703_142515 Ga0466703_142515_6949_7725 258
107 3300042636 Ga0466703_223867 Ga0466703_223867_340_1116 258
108 3300042643 Ga0466704_294216 Ga0466704_294216_1328_2104 258
109 3300042643 Ga0466704_422642 Ga0466704_422642_2707_3483 258
110 3300042655 Ga0466727_245486 Ga0466727_245486_997_1773 258
111 3300005485 Ga0074263_109376 Ga0074263_1093762 259
112 3300042592 Ga0466693_110507 Ga0466693_110507_56994_57773 259
113 3300042596 Ga0466696_118125 Ga0466696_118125_18092_18871 259
114 3300042604 Ga0466717_130261 Ga0466717_130261_993_1772 259
115 3300042606 Ga0466719_445851 Ga0466719_445851_947_1726 259
116 3300042619 Ga0466726_104810 Ga0466726_104810_2138_2917 259
117 3300042648 Ga0466709_289895 Ga0466709_289895_401_1180 259
118 3300042655 Ga0466727_097807 Ga0466727_097807_722_1501 259
119 iso_pr_bacteria 2781125663 2781338765 259
120 3300002449 JGI24698J34947_10017879 JGI24698J34947_100178793 260
121 3300010049 Ga0123356_10026741 Ga0123356_100267412 260
122 3300042594 Ga0466694_092283 Ga0466694_092283_39324_40106 260
123 3300042603 Ga0466714_004093 Ga0466714_004093_829_1611 260
124 3300042606 Ga0466719_088067 Ga0466719_088067_338_1120 260
125 3300042609 Ga0466722_268941 Ga0466722_268941_112_894 260
126 3300042615 Ga0466711_149344 Ga0466711_149344_6769_7551 260
127 3300042619 Ga0466726_109379 Ga0466726_109379_17303_18085 260
128 3300042620 Ga0466728_325091 Ga0466728_325091_745_1527 260
129 3300009826 Ga0123355_10150016 Ga0123355_101500163 261
130 3300042605 Ga0466716_200887 Ga0466716_200887_6366_7151 261
131 3300042607 Ga0466720_142847 Ga0466720_142847_22_807 261
132 3300042612 Ga0466705_278240 Ga0466705_278240_9245_10030 261
133 3300042617 Ga0466718_102338 Ga0466718_102338_89_874 261
134 3300042620 Ga0466728_366681 Ga0466728_366681_14449_15234 261
135 3300042652 Ga0466708_315395 Ga0466708_315395_3647_4432 261
136 3300042590 Ga0466690_251322 Ga0466690_251322_7298_8089 263
137 3300042592 Ga0466693_054771 Ga0466693_054771_523_1314 263
138 3300042618 Ga0466723_125622 Ga0466723_125622_31_822 263
139 3300042618 Ga0466723_181743 Ga0466723_181743_2527_3318 263
140 3300042643 Ga0466704_127982 Ga0466704_127982_17897_18688 263
141 3300042659 Ga0466733_002192 Ga0466733_002192_1990_2781 263
142 3300042596 Ga0466696_170739 Ga0466696_170739_10887_11681 264
143 3300042609 Ga0466722_008134 Ga0466722_008134_4341_5135 264
144 3300042620 Ga0466728_133863 Ga0466728_133863_3699_4571 264
145 3300042635 Ga0466702_040608 Ga0466702_040608_1373_2167 264
146 3300042635 Ga0466702_114240 Ga0466702_114240_2249_3043 264
147 3300042635 Ga0466702_224892 Ga0466702_224892_109_903 264
148 3300042635 Ga0466702_229430 Ga0466702_229430_11996_12790 264
149 iso_pr_bacteria 2781125634 2781274994 266
150 3300002450 JGI24695J34938_10031017 JGI24695J34938_100310173 267
151 3300042606 Ga0466719_486152 Ga0466719_486152_581_1384 267
152 3300042619 Ga0466726_317642 Ga0466726_317642_56_859 267
153 3300042636 Ga0466703_003860 Ga0466703_003860_15_818 267
154 3300042617 Ga0466718_109405 Ga0466718_109405_6885_7691 268
155 3300042594 Ga0466694_040445 Ga0466694_040445_3273_4085 270
156 3300042594 Ga0466694_215213 Ga0466694_215213_120_932 270
157 3300002449 JGI24698J34947_10009636 JGI24698J34947_100096362 271
158 3300010049 Ga0123356_10048856 Ga0123356_100488564 274
159 3300042636 Ga0466703_167798 Ga0466703_167798_6960_8003 274
160 iso_pr_bacteria 2781125693 2781433529 275
161 3300002450 JGI24695J34938_10001486 JGI24695J34938_1000148611 277
162 3300042652 Ga0466708_309870 Ga0466708_309870_52882_53730 282
163 3300042659 Ga0466733_148495 Ga0466733_148495_1578_2438 286
164 3300042612 Ga0466705_125368 Ga0466705_125368_3941_4888 295
165 3300042608 Ga0466721_230472 Ga0466721_230472_1189_2091 300

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00290 Trp_syntA Tryptophan synthase alpha chain 31 292 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.