Protein Family IF07080
Metagenome
Isolate
226
Members
64
Samples
220
Scaffolds
203.72
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_073856|Ga0466705_073856_2056_2715
- Length
- 219 aa
- Sequence
- MHPEILTKEQIELLPLIQQFRREFYLVGGTAIALQLGHRRSIDFDLFKQSTLNTTKTLKKVDAVKMSYVVTYRVSEQINLVMNAVKITFVQYPYPIVAVKDFEKKIRMPGLLTLAAMKAFALERRSKWKDYVDLYFLLKDHFSVKDISREADRIFGQLFSEKLFRSQLAFHKDIDYSEPVEYMSGFEADEQEVKDFLTDKSLQEISDKRVIKRKRQPVD
Sample Types
Isolate
2.6%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
51.6%
Kalotermitidae
22.6%
Unclassified
11.3%
Termopsidae
6.5%
Passalidae
3.2%
Rhinotermitidae
3.2%
Hodotermitidae
1.6%
Taxonomy
Archaea
2
Bacteria
207
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 9 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2820852808 | Unclassified Actinobacteria Lab288P3bin25 | Isolate | Unclassified |
| 15 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 21 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 25 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 26 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 33 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 34 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 35 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 36 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 37 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 41 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 44 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 45 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 46 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 49 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 50 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 51 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 52 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 53 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 54 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 55 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 56 | 2820874551 | Unclassified Actinobacteria Lab288P1bin85 | Isolate | Unclassified |
| 57 | 2820208273 | Unclassified Microgenomates Th196P3bin94 | Isolate | Unclassified |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 60 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 61 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 62 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 63 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 64 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_093545 | 3300042611 | Bacteria | 2839 |
| 2 | Ga0466705_372784 | 3300042612 | Bacteria | 2081 |
| 3 | Ga0466732_092386 | 3300042656 | Bacteria | 77086 |
| 4 | Ga0466732_133239 | 3300042656 | Bacteria | 10995 |
| 5 | Ga0466657_005071 | 3300042582 | Bacteria | 1688 |
| 6 | Ga0466713_073721 | 3300042602 | Bacteria | 3717 |
| 7 | Ga0466714_101842 | 3300042603 | Bacteria | 80008 |
| 8 | Ga0466717_126940 | 3300042604 | Bacteria | 2024 |
| 9 | Ga0466712_034106 | 3300042614 | Bacteria | 10376 |
| 10 | Ga0466711_141242 | 3300042615 | Bacteria | 6832 |
| 11 | Ga0466723_292032 | 3300042618 | Bacteria | 4832 |
| 12 | Ga0466726_004378 | 3300042619 | Bacteria | 1578 |
| 13 | Ga0466726_226032 | 3300042619 | Bacteria | 4967 |
| 14 | Ga0466729_162305 | 3300042621 | Bacteria | 1234 |
| 15 | 2227624633 | 2225789004 | Bacteria | 11590 |
| 16 | IMNBL1DRAFT_c0057400 | 3300000062 | Bacteria | 1188 |
| 17 | JGI24698J34947_10025681 | 3300002449 | Unclassified | 3133 |
| 18 | Ga0466734_006799 | 3300042623 | Bacteria | 6655 |
| 19 | Ga0466709_062901 | 3300042648 | Bacteria | 45932 |
| 20 | Ga0123357_10009595 | 3300009784 | Bacteria | 12228 |
| 21 | Ga0123357_10117414 | 3300009784 | Bacteria | 3366 |
| 22 | Ga0123356_10342829 | 3300010049 | Bacteria | 1615 |
| 23 | Ga0123353_10985417 | 3300010167 | Unclassified | 1135 |
| 24 | Ga0123353_11109595 | 3300010167 | Bacteria | 1049 |
| 25 | Ga0123354_10474840 | 3300010882 | Bacteria | 994 |
| 26 | Ga0466705_228317 | 3300042612 | Bacteria | 15369 |
| 27 | Ga0466693_153526 | 3300042592 | Bacteria | 1268 |
| 28 | Ga0466700_220020 | 3300042600 | Bacteria | 6160 |
| 29 | Ga0466697_047585 | 3300042611 | Bacteria | 2035 |
| 30 | Ga0466715_296742 | 3300042616 | Bacteria | 21767 |
| 31 | Ga0466718_100269 | 3300042617 | Unclassified | 4074 |
| 32 | Ga0466726_318016 | 3300042619 | Bacteria | 2535 |
| 33 | Ga0466729_183034 | 3300042621 | Bacteria | 2692 |
| 34 | JGI24695J34938_10011030 | 3300002450 | Bacteria | 4901 |
| 35 | JGI24702J35022_10346523 | 3300002462 | Bacteria | 887 |
| 36 | JGI24705J35276_12236874 | 3300002504 | Bacteria | 9147 |
| 37 | Ga0072941_1005569 | 3300005201 | Bacteria | 9844 |
| 38 | Ga0466731_006553 | 3300042622 | Bacteria | 2253 |
| 39 | Ga0466735_175701 | 3300042624 | Bacteria | 1418 |
| 40 | Ga0466704_086936 | 3300042643 | Bacteria | 9412 |
| 41 | Ga0466704_310640 | 3300042643 | Bacteria | 14809 |
| 42 | Ga0123357_10097493 | 3300009784 | Bacteria | 3803 |
| 43 | Ga0123356_10800630 | 3300010049 | Bacteria | 1113 |
| 44 | Ga0123353_10175166 | 3300010167 | Bacteria | 3401 |
| 45 | Ga0123354_10239626 | 3300010882 | Unclassified | 1870 |
| 46 | Ga0466705_073856 | 3300042612 | Bacteria | 3039 |
| 47 | Ga0264413_126979 | 3300024493 | Bacteria | 5520 |
| 48 | Ga0466656_267012 | 3300042550 | Bacteria | 1209 |
| 49 | Ga0466657_391958 | 3300042582 | Bacteria | 2301 |
| 50 | Ga0466695_281853 | 3300042595 | Bacteria | 2278 |
| 51 | Ga0466696_404375 | 3300042596 | Bacteria | 1611 |
| 52 | Ga0466701_044436 | 3300042598 | Bacteria | 1979 |
| 53 | Ga0466701_054590 | 3300042598 | Bacteria | 4566 |
| 54 | Ga0466713_022751 | 3300042602 | Bacteria | 1296 |
| 55 | Ga0466716_210747 | 3300042605 | Unclassified | 1438 |
| 56 | Ga0466722_130321 | 3300042609 | Bacteria | 1779 |
| 57 | Ga0466722_228322 | 3300042609 | Bacteria | 9734 |
| 58 | Ga0466712_008162 | 3300042614 | Unclassified | 1532 |
| 59 | Ga0466718_112922 | 3300042617 | Bacteria | 1483 |
| 60 | IMNBL1DRAFT_c0066114 | 3300000062 | Bacteria | 1063 |
| 61 | JGI24702J35022_10029755 | 3300002462 | Bacteria | 2930 |
| 62 | JGI24705J35276_12178798 | 3300002504 | Bacteria | 1350 |
| 63 | JGI24696J40584_12764914 | 3300002834 | Bacteria | 813 |
| 64 | Ga0466725_073279 | 3300042654 | Bacteria | 1292 |
| 65 | Ga0123356_10112308 | 3300010049 | Bacteria | 2634 |
| 66 | Ga0123356_10422121 | 3300010049 | Bacteria | 1476 |
| 67 | Ga0123353_10415012 | 3300010167 | Bacteria | 1997 |
| 68 | Ga0123353_10957476 | 3300010167 | Bacteria | 1157 |
| 69 | Ga0123353_10975033 | 3300010167 | Bacteria | 1143 |
| 70 | Ga0123354_10074067 | 3300010882 | Unclassified | 4882 |
| 71 | Ga0123354_10164132 | 3300010882 | Bacteria | 2620 |
| 72 | Ga0123354_10316307 | 3300010882 | Bacteria | 1449 |
| 73 | Ga0123354_10428057 | 3300010882 | Unclassified | 1093 |
| 74 | Ga0123354_10482059 | 3300010882 | Bacteria | 980 |
| 75 | Ga0466656_129332 | 3300042550 | Bacteria | 1230 |
| 76 | Ga0466690_137052 | 3300042590 | Bacteria | 4158 |
| 77 | Ga0466721_093267 | 3300042608 | Bacteria | 1427 |
| 78 | Ga0466712_200404 | 3300042614 | Bacteria | 24744 |
| 79 | Ga0466715_014674 | 3300042616 | Bacteria | 3471 |
| 80 | Ga0466715_081240 | 3300042616 | Bacteria | 14184 |
| 81 | Ga0466715_226637 | 3300042616 | Bacteria | 1991 |
| 82 | Ga0466723_206036 | 3300042618 | Bacteria | 2086 |
| 83 | Ga0466726_041613 | 3300042619 | Bacteria | 1081 |
| 84 | Ga0466726_337905 | 3300042619 | Bacteria | 1248 |
| 85 | Ga0466728_095178 | 3300042620 | Unclassified | 6588 |
| 86 | JGI24702J35022_10000299 | 3300002462 | Bacteria | 29188 |
| 87 | JGI24702J35022_10006328 | 3300002462 | Bacteria | 6849 |
| 88 | JGI24696J40584_12913617 | 3300002834 | Unclassified | 1278 |
| 89 | JGI24696J40584_12920186 | 3300002834 | Bacteria | 1340 |
| 90 | Ga0123357_10000282 | 3300009784 | Bacteria | 48587 |
| 91 | Ga0466729_221248 | 3300042621 | Bacteria | 2007 |
| 92 | Ga0466731_019835 | 3300042622 | Bacteria | 2032 |
| 93 | Ga0466731_028243 | 3300042622 | Bacteria | 1465 |
| 94 | Ga0466731_161518 | 3300042622 | Bacteria | 1769 |
| 95 | Ga0466734_061389 | 3300042623 | Bacteria | 1077 |
| 96 | Ga0466734_105571 | 3300042623 | Bacteria | 1320 |
| 97 | Ga0466727_157588 | 3300042655 | Bacteria | 11902 |
| 98 | Ga0466727_234286 | 3300042655 | Bacteria | 6510 |
| 99 | Ga0466727_243930 | 3300042655 | Bacteria | 2823 |
| 100 | Ga0123357_10004066 | 3300009784 | Bacteria | 17038 |
| 101 | Ga0123356_10000443 | 3300010049 | Bacteria | 47239 |
| 102 | Ga0123356_10021432 | 3300010049 | Bacteria | 6098 |
| 103 | Ga0123356_10618535 | 3300010049 | Bacteria | 1249 |
| 104 | Ga0123356_11911761 | 3300010049 | Unclassified | 739 |
| 105 | Ga0123353_10001583 | 3300010167 | Bacteria | 27977 |
| 106 | Ga0123354_10401736 | 3300010882 | Bacteria | 1159 |
| 107 | Ga0466705_159936 | 3300042612 | Bacteria | 3588 |
| 108 | Ga0466732_101361 | 3300042656 | Bacteria | 5731 |
| 109 | Ga0466693_004516 | 3300042592 | Bacteria | 1246 |
| 110 | Ga0466694_026663 | 3300042594 | Bacteria | 1206 |
| 111 | Ga0466706_007092 | 3300042599 | Bacteria | 17739 |
| 112 | Ga0466714_082000 | 3300042603 | Bacteria | 5183 |
| 113 | Ga0466717_256331 | 3300042604 | Unclassified | 2225 |
| 114 | Ga0466716_277725 | 3300042605 | Bacteria | 2126 |
| 115 | Ga0466719_541804 | 3300042606 | Bacteria | 1832 |
| 116 | Ga0466719_574669 | 3300042606 | Bacteria | 1492 |
| 117 | Ga0466720_176372 | 3300042607 | Unclassified | 2644 |
| 118 | Ga0466705_475828 | 3300042612 | Bacteria | 24901 |
| 119 | Ga0466712_127589 | 3300042614 | Bacteria | 1175 |
| 120 | Ga0466715_176910 | 3300042616 | Bacteria | 2171 |
| 121 | Ga0466715_233693 | 3300042616 | Bacteria | 1169 |
| 122 | Ga0466715_595860 | 3300042616 | Bacteria | 3770 |
| 123 | Ga0466726_003413 | 3300042619 | Bacteria | 1520 |
| 124 | JGI24695J34938_10094780 | 3300002450 | Bacteria | 1223 |
| 125 | JGI24702J35022_10006378 | 3300002462 | Bacteria | 6822 |
| 126 | JGI24702J35022_10033428 | 3300002462 | Bacteria | 2752 |
| 127 | JGI24696J40584_12953508 | 3300002834 | Bacteria | 2495 |
| 128 | Ga0072940_1050229 | 3300005200 | Bacteria | 6479 |
| 129 | Ga0466724_28307 | 3300042649 | Bacteria | 1021 |
| 130 | Ga0466708_173264 | 3300042652 | Bacteria | 5334 |
| 131 | Ga0123356_10000833 | 3300010049 | Bacteria | 34368 |
| 132 | Ga0123356_10004830 | 3300010049 | Bacteria | 13868 |
| 133 | Ga0123356_10120437 | 3300010049 | Bacteria | 2551 |
| 134 | Ga0123354_10095749 | 3300010882 | Bacteria | 4061 |
| 135 | Ga0123354_10493964 | 3300010882 | Bacteria | 959 |
| 136 | Ga0466733_154636 | 3300042659 | Bacteria | 2315 |
| 137 | Ga0466693_074140 | 3300042592 | Bacteria | 1127 |
| 138 | Ga0466691_099575 | 3300042593 | Bacteria | 3647 |
| 139 | Ga0466698_493531 | 3300042610 | Bacteria | 1542 |
| 140 | Ga0466710_038116 | 3300042613 | Bacteria | 4563 |
| 141 | Ga0466710_369580 | 3300042613 | Bacteria | 1137 |
| 142 | Ga0466718_095226 | 3300042617 | Bacteria | 2074 |
| 143 | 2227513252 | 2225789004 | Bacteria | 3506 |
| 144 | JGI24702J35022_10193159 | 3300002462 | Bacteria | 1162 |
| 145 | Ga0123357_10000911 | 3300009784 | Bacteria | 30046 |
| 146 | Ga0466735_209826 | 3300042624 | Bacteria | 1360 |
| 147 | Ga0466704_133752 | 3300042643 | Bacteria | 1187 |
| 148 | Ga0466704_621643 | 3300042643 | Bacteria | 2541 |
| 149 | Ga0466725_023337 | 3300042654 | Bacteria | 3044 |
| 150 | Ga0466725_132686 | 3300042654 | Bacteria | 1362 |
| 151 | Ga0466727_041012 | 3300042655 | Bacteria | 1599 |
| 152 | Ga0123357_10269588 | 3300009784 | Bacteria | 1782 |
| 153 | Ga0123357_10462190 | 3300009784 | Bacteria | 1090 |
| 154 | Ga0123356_10355027 | 3300010049 | Bacteria | 1591 |
| 155 | Ga0123356_10641977 | 3300010049 | Unclassified | 1228 |
| 156 | Ga0123356_11537912 | 3300010049 | Bacteria | 822 |
| 157 | Ga0123353_10509626 | 3300010167 | Bacteria | 1750 |
| 158 | Ga0123353_10611367 | 3300010167 | Bacteria | 1555 |
| 159 | Ga0123353_11405455 | 3300010167 | Bacteria | 897 |
| 160 | Ga0123354_10162242 | 3300010882 | Bacteria | 2647 |
| 161 | Ga0123354_10486377 | 3300010882 | Bacteria | 972 |
| 162 | Ga0466697_273171 | 3300042611 | Bacteria | 1950 |
| 163 | Ga0466657_242768 | 3300042582 | Bacteria | 1378 |
| 164 | Ga0466690_287039 | 3300042590 | Bacteria | 2105 |
| 165 | Ga0466690_378465 | 3300042590 | Bacteria | 2180 |
| 166 | Ga0466691_066615 | 3300042593 | Bacteria | 3292 |
| 167 | Ga0466701_019969 | 3300042598 | Bacteria | 1778 |
| 168 | Ga0466713_123039 | 3300042602 | Bacteria | 4169 |
| 169 | Ga0466719_078358 | 3300042606 | Bacteria | 3178 |
| 170 | Ga0466722_091909 | 3300042609 | Bacteria | 2741 |
| 171 | Ga0466722_166973 | 3300042609 | Bacteria | 14816 |
| 172 | Ga0466710_218508 | 3300042613 | Bacteria | 1703 |
| 173 | Ga0466711_283470 | 3300042615 | Unclassified | 1885 |
| 174 | Ga0466715_445813 | 3300042616 | Archaea | 1602 |
| 175 | Ga0466726_038328 | 3300042619 | Bacteria | 2319 |
| 176 | Ga0466728_059598 | 3300042620 | Bacteria | 1053 |
| 177 | JGI24702J35022_10016537 | 3300002462 | Bacteria | 4042 |
| 178 | JGI24705J35276_12140395 | 3300002504 | Bacteria | 1138 |
| 179 | JGI24696J40584_12724816 | 3300002834 | Bacteria | 763 |
| 180 | Ga0072940_1498556 | 3300005200 | Bacteria | 2499 |
| 181 | Ga0123357_10001807 | 3300009784 | Bacteria | 23177 |
| 182 | Ga0466704_020556 | 3300042643 | Bacteria | 26195 |
| 183 | Ga0466709_071758 | 3300042648 | Bacteria | 1634 |
| 184 | Ga0466709_300938 | 3300042648 | Bacteria | 3982 |
| 185 | Ga0466725_332404 | 3300042654 | Bacteria | 2866 |
| 186 | Ga0466727_107036 | 3300042655 | Bacteria | 1258 |
| 187 | Ga0123356_12024809 | 3300010049 | Bacteria | 718 |
| 188 | Ga0123353_10456463 | 3300010167 | Bacteria | 1879 |
| 189 | Ga0123353_10552482 | 3300010167 | Bacteria | 1660 |
| 190 | Ga0466705_236575 | 3300042612 | Unclassified | 8101 |
| 191 | Ga0466691_017761 | 3300042593 | Bacteria | 9508 |
| 192 | Ga0466694_378844 | 3300042594 | Bacteria | 1163 |
| 193 | Ga0466695_293673 | 3300042595 | Bacteria | 2142 |
| 194 | Ga0466701_062819 | 3300042598 | Bacteria | 1221 |
| 195 | Ga0466720_065410 | 3300042607 | Bacteria | 38105 |
| 196 | Ga0466712_295084 | 3300042614 | Bacteria | 5122 |
| 197 | Ga0466718_147523 | 3300042617 | Archaea | 4115 |
| 198 | Ga0466726_306020 | 3300042619 | Bacteria | 3128 |
| 199 | JGI24698J34947_10001562 | 3300002449 | Bacteria | 12119 |
| 200 | JGI24698J34947_10176894 | 3300002449 | Unclassified | 857 |
| 201 | JGI24702J35022_10002451 | 3300002462 | Bacteria | 11312 |
| 202 | JGI24702J35022_10060034 | 3300002462 | Bacteria | 2032 |
| 203 | Ga0068302_10324686 | 3300005071 | Bacteria | 4330 |
| 204 | Ga0123357_10002070 | 3300009784 | Bacteria | 22018 |
| 205 | Ga0466734_155865 | 3300042623 | Bacteria | 13764 |
| 206 | Ga0466735_007034 | 3300042624 | Bacteria | 1698 |
| 207 | Ga0466735_223724 | 3300042624 | Bacteria | 3418 |
| 208 | Ga0466703_124896 | 3300042636 | Bacteria | 3246 |
| 209 | Ga0466703_245708 | 3300042636 | Bacteria | 1275 |
| 210 | Ga0466704_343215 | 3300042643 | Bacteria | 4821 |
| 211 | Ga0466708_360525 | 3300042652 | Bacteria | 1879 |
| 212 | Ga0466725_314069 | 3300042654 | Bacteria | 9624 |
| 213 | Ga0466727_160013 | 3300042655 | Bacteria | 2035 |
| 214 | Ga0466727_270174 | 3300042655 | Bacteria | 2549 |
| 215 | Ga0123356_11231446 | 3300010049 | Bacteria | 914 |
| 216 | Ga0123356_11502943 | 3300010049 | Bacteria | 831 |
| 217 | Ga0123353_10244583 | 3300010167 | Bacteria | 2784 |
| 218 | Ga0123353_10301104 | 3300010167 | Bacteria | 2447 |
| 219 | Ga0123353_10685671 | 3300010167 | Bacteria | 1442 |
| 220 | Ga0123353_10912108 | 3300010167 | Bacteria | 1194 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08843 | AbiEii | Nucleotidyl transferase AbiEii toxin, Type IV TA system | 19 | 153 | 0.67 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.