Protein Family IF07040
Metagenome
Isolate
213
Members
50
Samples
205
Scaffolds
337.68
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_013226|Ga0466705_013226_26_1279
- Length
- 400 aa
- Sequence
- LDKLLEKPVKSPVFPLNSRKLFQKLKFWNSLSFMQKFADEALIEVVSGKGGNGCVSFRREKYVPRGGPDVVFEVRRNLRTLAHLRYKQSFKAENGRDGEGSQRHGRNGADVFVPVPPGTVLKHKETGEIIRDFGKDEGKFVFLTGGNGGWGNVHFKSATNQAPRKALPGLPGKQRELRVEMRILADIGLVGFPNAGKSSLLDRFTNARPKIAPYPFTTKIPNLGVLTLGERDIIIADIPGLIDGASQGAGLGIRFLKHISRTLGLVFLIDLGENSFLEAFDVLHHELNAFSPELVRKPHIIVGSKTDLEGASERLEALREKYEGKPDLSGGQGLPHERVLGISVFTGEGLSELTAAIGALVDRLDRGGTPDKEAEAWTDLPDVWDAEADGTESDGEGTAR
Sample Types
Isolate
3.8%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.4%
Kalotermitidae
29.2%
Unclassified
18.8%
Rhinotermitidae
6.2%
Termopsidae
6.2%
Blaberidae
2.1%
Hodotermitidae
2.1%
Taxonomy
Archaea
1
Bacteria
206
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 18 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 27 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 38 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 39 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 40 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 41 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 45 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 46 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 47 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 48 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 49 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 50 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10004344 | 3300010049 | Bacteria | 14657 |
| 2 | Ga0123353_10085671 | 3300010167 | Bacteria | 5074 |
| 3 | Ga0466690_127509 | 3300042590 | Bacteria | 20260 |
| 4 | Ga0466691_056599 | 3300042593 | Bacteria | 4900 |
| 5 | Ga0466694_055872 | 3300042594 | Bacteria | 2925 |
| 6 | Ga0466705_150025 | 3300042612 | Bacteria | 7080 |
| 7 | Ga0466705_211043 | 3300042612 | Bacteria | 3138 |
| 8 | Ga0466705_385058 | 3300042612 | Bacteria | 3471 |
| 9 | Ga0466712_100975 | 3300042614 | Bacteria | 25676 |
| 10 | Ga0466715_256297 | 3300042616 | Bacteria | 1810 |
| 11 | Ga0466715_325216 | 3300042616 | Bacteria | 1587 |
| 12 | Ga0466718_003822 | 3300042617 | Bacteria | 10239 |
| 13 | Ga0466718_093252 | 3300042617 | Bacteria | 8061 |
| 14 | Ga0466718_165619 | 3300042617 | Bacteria | 1963 |
| 15 | Ga0466726_073556 | 3300042619 | Bacteria | 6554 |
| 16 | Ga0466706_182991 | 3300042599 | Bacteria | 2509 |
| 17 | Ga0466706_249952 | 3300042599 | Bacteria | 1331 |
| 18 | Ga0466716_329389 | 3300042605 | Bacteria | 13607 |
| 19 | Ga0466720_176232 | 3300042607 | Bacteria | 2185 |
| 20 | Ga0466720_238434 | 3300042607 | Unclassified | 2094 |
| 21 | Ga0466703_283225 | 3300042636 | Bacteria | 6229 |
| 22 | Ga0466704_204218 | 3300042643 | Bacteria | 13888 |
| 23 | Ga0466709_412539 | 3300042648 | Bacteria | 6486 |
| 24 | JGI24698J34947_10001529 | 3300002449 | Bacteria | 12244 |
| 25 | JGI24698J34947_10092524 | 3300002449 | Unclassified | 1382 |
| 26 | JGI24695J34938_10000637 | 3300002450 | Bacteria | 33482 |
| 27 | JGI24695J34938_10046403 | 3300002450 | Bacteria | 1923 |
| 28 | Ga0072941_1001487 | 3300005201 | Bacteria | 51851 |
| 29 | Ga0466732_028735 | 3300042656 | Bacteria | 2923 |
| 30 | Ga0466732_401976 | 3300042656 | Bacteria | 1486 |
| 31 | Ga0466690_109615 | 3300042590 | Bacteria | 1667 |
| 32 | Ga0466696_008942 | 3300042596 | Bacteria | 13122 |
| 33 | Ga0466705_156372 | 3300042612 | Bacteria | 5377 |
| 34 | Ga0466711_250165 | 3300042615 | Bacteria | 77191 |
| 35 | Ga0466711_250812 | 3300042615 | Bacteria | 11619 |
| 36 | Ga0466711_253954 | 3300042615 | Bacteria | 3775 |
| 37 | Ga0466715_333621 | 3300042616 | Bacteria | 6602 |
| 38 | Ga0466718_026446 | 3300042617 | Bacteria | 5425 |
| 39 | Ga0466723_240892 | 3300042618 | Bacteria | 8173 |
| 40 | Ga0466728_032581 | 3300042620 | Bacteria | 5309 |
| 41 | Ga0466716_037044 | 3300042605 | Bacteria | 9609 |
| 42 | Ga0466719_115475 | 3300042606 | Bacteria | 1540 |
| 43 | Ga0466720_030192 | 3300042607 | Unclassified | 2225 |
| 44 | Ga0466731_351701 | 3300042622 | Bacteria | 1129 |
| 45 | Ga0466703_067885 | 3300042636 | Bacteria | 12307 |
| 46 | Ga0466704_013796 | 3300042643 | Bacteria | 7450 |
| 47 | Ga0466704_050446 | 3300042643 | Bacteria | 8805 |
| 48 | Ga0466709_267657 | 3300042648 | Bacteria | 5657 |
| 49 | Ga0466708_109511 | 3300042652 | Bacteria | 32313 |
| 50 | Ga0466708_415820 | 3300042652 | Bacteria | 7007 |
| 51 | Ga0466727_175783 | 3300042655 | Bacteria | 2424 |
| 52 | JGI24698J34947_10083380 | 3300002449 | Bacteria | 1492 |
| 53 | JGI24698J34947_10097406 | 3300002449 | Unclassified | 1332 |
| 54 | Ga0072941_1001602 | 3300005201 | Bacteria | 5292 |
| 55 | Ga0123357_10109183 | 3300009784 | Bacteria | 3535 |
| 56 | Ga0466690_104131 | 3300042590 | Bacteria | 5146 |
| 57 | Ga0466691_027942 | 3300042593 | Bacteria | 4125 |
| 58 | Ga0466691_159900 | 3300042593 | Bacteria | 20972 |
| 59 | Ga0466696_162866 | 3300042596 | Bacteria | 3020 |
| 60 | Ga0466705_100015 | 3300042612 | Bacteria | 3527 |
| 61 | Ga0466705_350550 | 3300042612 | Bacteria | 2877 |
| 62 | Ga0466711_310299 | 3300042615 | Bacteria | 29275 |
| 63 | Ga0466723_281403 | 3300042618 | Bacteria | 9375 |
| 64 | Ga0466726_009489 | 3300042619 | Bacteria | 24070 |
| 65 | Ga0466726_076301 | 3300042619 | Bacteria | 7101 |
| 66 | Ga0466726_357811 | 3300042619 | Bacteria | 1358 |
| 67 | Ga0466728_015487 | 3300042620 | Bacteria | 17071 |
| 68 | Ga0466728_026076 | 3300042620 | Bacteria | 2335 |
| 69 | Ga0466728_226367 | 3300042620 | Bacteria | 1171 |
| 70 | Ga0466702_447581 | 3300042635 | Bacteria | 27549 |
| 71 | Ga0466703_155064 | 3300042636 | Bacteria | 43492 |
| 72 | Ga0466709_066076 | 3300042648 | Bacteria | 20720 |
| 73 | Ga0466709_137960 | 3300042648 | Bacteria | 14959 |
| 74 | Ga0466709_186278 | 3300042648 | Bacteria | 13121 |
| 75 | Ga0466708_084097 | 3300042652 | Bacteria | 1309 |
| 76 | Ga0466708_101893 | 3300042652 | Bacteria | 12133 |
| 77 | Ga0466708_395971 | 3300042652 | Bacteria | 9045 |
| 78 | Ga0466708_422796 | 3300042652 | Bacteria | 20480 |
| 79 | Ga0466733_183233 | 3300042659 | Bacteria | 53898 |
| 80 | Ga0123355_10341565 | 3300009826 | Bacteria | 1994 |
| 81 | Ga0123356_10209484 | 3300010049 | Bacteria | 1996 |
| 82 | Ga0466691_061889 | 3300042593 | Bacteria | 7226 |
| 83 | Ga0466694_053057 | 3300042594 | Bacteria | 8149 |
| 84 | Ga0466694_164538 | 3300042594 | Bacteria | 11631 |
| 85 | Ga0466696_100035 | 3300042596 | Bacteria | 5023 |
| 86 | Ga0466696_332106 | 3300042596 | Bacteria | 4141 |
| 87 | Ga0466705_449006 | 3300042612 | Bacteria | 3161 |
| 88 | Ga0466712_037661 | 3300042614 | Bacteria | 33888 |
| 89 | Ga0466712_323615 | 3300042614 | Bacteria | 2192 |
| 90 | Ga0466715_318973 | 3300042616 | Bacteria | 17304 |
| 91 | Ga0466718_132395 | 3300042617 | Bacteria | 30532 |
| 92 | Ga0466726_152006 | 3300042619 | Bacteria | 21454 |
| 93 | Ga0466726_165867 | 3300042619 | Bacteria | 10046 |
| 94 | Ga0466728_003349 | 3300042620 | Bacteria | 20132 |
| 95 | Ga0466728_085569 | 3300042620 | Bacteria | 1905 |
| 96 | Ga0466700_071651 | 3300042600 | Bacteria | 8111 |
| 97 | Ga0466700_373279 | 3300042600 | Bacteria | 1651 |
| 98 | Ga0466707_140104 | 3300042601 | Bacteria | 1717 |
| 99 | Ga0466719_185367 | 3300042606 | Bacteria | 23758 |
| 100 | Ga0466722_039120 | 3300042609 | Bacteria | 18444 |
| 101 | Ga0466722_086139 | 3300042609 | Bacteria | 11161 |
| 102 | Ga0466722_121525 | 3300042609 | Bacteria | 2472 |
| 103 | Ga0466735_029017 | 3300042624 | Bacteria | 5202 |
| 104 | Ga0466735_200935 | 3300042624 | Bacteria | 4926 |
| 105 | Ga0466703_153577 | 3300042636 | Bacteria | 30864 |
| 106 | Ga0466704_118484 | 3300042643 | Bacteria | 17799 |
| 107 | Ga0466704_122050 | 3300042643 | Bacteria | 2488 |
| 108 | Ga0466709_097750 | 3300042648 | Bacteria | 6047 |
| 109 | Ga0466709_287184 | 3300042648 | Bacteria | 3065 |
| 110 | Ga0466709_377279 | 3300042648 | Bacteria | 4374 |
| 111 | Ga0466708_080723 | 3300042652 | Bacteria | 29464 |
| 112 | Ga0466727_319033 | 3300042655 | Bacteria | 4037 |
| 113 | AustNasuHG_c1012207 | 3300000089 | Bacteria | 2968 |
| 114 | JGI24698J34947_10055804 | 3300002449 | Bacteria | 1966 |
| 115 | Ga0123357_10104656 | 3300009784 | Bacteria | 3633 |
| 116 | Ga0466690_150474 | 3300042590 | Bacteria | 9045 |
| 117 | Ga0466699_076644 | 3300042597 | Bacteria | 9216 |
| 118 | Ga0466705_472736 | 3300042612 | Bacteria | 9326 |
| 119 | Ga0466711_053127 | 3300042615 | Bacteria | 43418 |
| 120 | Ga0466718_014487 | 3300042617 | Bacteria | 2204 |
| 121 | Ga0466726_195870 | 3300042619 | Bacteria | 2673 |
| 122 | Ga0466726_260358 | 3300042619 | Bacteria | 1602 |
| 123 | Ga0466726_288065 | 3300042619 | Bacteria | 1766 |
| 124 | Ga0466713_117442 | 3300042602 | Bacteria | 35689 |
| 125 | Ga0466713_127097 | 3300042602 | Bacteria | 1937 |
| 126 | Ga0466716_025536 | 3300042605 | Bacteria | 1675 |
| 127 | Ga0466703_404390 | 3300042636 | Bacteria | 1633 |
| 128 | Ga0466704_508178 | 3300042643 | Bacteria | 10738 |
| 129 | Ga0466704_555238 | 3300042643 | Bacteria | 15816 |
| 130 | Ga0466709_178119 | 3300042648 | Bacteria | 18589 |
| 131 | Ga0466708_177332 | 3300042652 | Bacteria | 7585 |
| 132 | AustNasuHG_c1011853 | 3300000089 | Bacteria | 3018 |
| 133 | JGI24695J34938_10021456 | 3300002450 | Bacteria | 3158 |
| 134 | Ga0072941_1002368 | 3300005201 | Bacteria | 28238 |
| 135 | Ga0123356_10011162 | 3300010049 | Unclassified | 8771 |
| 136 | Ga0123353_10361788 | 3300010167 | Bacteria | 2180 |
| 137 | Ga0466690_120294 | 3300042590 | Bacteria | 1773 |
| 138 | Ga0466690_382698 | 3300042590 | Archaea | 3240 |
| 139 | Ga0466691_119958 | 3300042593 | Bacteria | 6360 |
| 140 | Ga0466696_178000 | 3300042596 | Bacteria | 14411 |
| 141 | Ga0466696_186862 | 3300042596 | Bacteria | 11940 |
| 142 | Ga0466723_027731 | 3300042618 | Bacteria | 3682 |
| 143 | Ga0466723_107104 | 3300042618 | Bacteria | 6262 |
| 144 | Ga0466726_484548 | 3300042619 | Bacteria | 1826 |
| 145 | Ga0466707_296798 | 3300042601 | Bacteria | 2018 |
| 146 | Ga0466716_025117 | 3300042605 | Bacteria | 10366 |
| 147 | Ga0466716_397501 | 3300042605 | Bacteria | 9652 |
| 148 | Ga0466735_006951 | 3300042624 | Bacteria | 1153 |
| 149 | Ga0466703_129185 | 3300042636 | Bacteria | 5129 |
| 150 | Ga0466703_431977 | 3300042636 | Bacteria | 13340 |
| 151 | Ga0466704_118706 | 3300042643 | Bacteria | 1901 |
| 152 | Ga0466704_286879 | 3300042643 | Bacteria | 12770 |
| 153 | Ga0466709_238246 | 3300042648 | Bacteria | 2738 |
| 154 | Ga0123357_10000033 | 3300009784 | Bacteria | 113776 |
| 155 | Ga0466732_058764 | 3300042656 | Bacteria | 1305 |
| 156 | Ga0264413_111411 | 3300024493 | Bacteria | 5066 |
| 157 | Ga0456237_0000891 | 3300041968 | Bacteria | 4686 |
| 158 | Ga0456237_0001331 | 3300041968 | Bacteria | 3918 |
| 159 | Ga0466690_353099 | 3300042590 | Bacteria | 4572 |
| 160 | Ga0466692_012716 | 3300042591 | Bacteria | 1588 |
| 161 | Ga0466691_137989 | 3300042593 | Bacteria | 6566 |
| 162 | Ga0466694_212755 | 3300042594 | Bacteria | 1475 |
| 163 | Ga0466696_294960 | 3300042596 | Bacteria | 9936 |
| 164 | Ga0466705_013226 | 3300042612 | Bacteria | 3274 |
| 165 | Ga0466712_078253 | 3300042614 | Unclassified | 7901 |
| 166 | Ga0466711_128611 | 3300042615 | Bacteria | 3441 |
| 167 | Ga0466711_229884 | 3300042615 | Bacteria | 15610 |
| 168 | Ga0466711_289524 | 3300042615 | Bacteria | 53110 |
| 169 | Ga0466711_400322 | 3300042615 | Bacteria | 9093 |
| 170 | Ga0466715_207140 | 3300042616 | Bacteria | 11674 |
| 171 | Ga0466718_037862 | 3300042617 | Bacteria | 2222 |
| 172 | Ga0466723_055423 | 3300042618 | Bacteria | 3875 |
| 173 | Ga0466723_217497 | 3300042618 | Bacteria | 11514 |
| 174 | Ga0466726_331833 | 3300042619 | Bacteria | 8637 |
| 175 | Ga0466728_258011 | 3300042620 | Bacteria | 19471 |
| 176 | Ga0466707_306220 | 3300042601 | Bacteria | 3420 |
| 177 | Ga0466716_119424 | 3300042605 | Bacteria | 30510 |
| 178 | Ga0466720_094992 | 3300042607 | Bacteria | 4287 |
| 179 | Ga0466722_006834 | 3300042609 | Bacteria | 16524 |
| 180 | Ga0466722_152317 | 3300042609 | Bacteria | 1482 |
| 181 | Ga0466703_020390 | 3300042636 | Bacteria | 20134 |
| 182 | Ga0466703_025357 | 3300042636 | Bacteria | 21751 |
| 183 | Ga0466708_115305 | 3300042652 | Bacteria | 7290 |
| 184 | Ga0072941_1002220 | 3300005201 | Bacteria | 30258 |
| 185 | Ga0466733_061333 | 3300042659 | Bacteria | 4109 |
| 186 | Ga0123356_10002837 | 3300010049 | Bacteria | 18343 |
| 187 | Ga0466690_172258 | 3300042590 | Bacteria | 9600 |
| 188 | Ga0466692_023781 | 3300042591 | Bacteria | 21532 |
| 189 | Ga0466694_003523 | 3300042594 | Bacteria | 13955 |
| 190 | Ga0466696_491314 | 3300042596 | Bacteria | 9284 |
| 191 | Ga0466705_418084 | 3300042612 | Bacteria | 5396 |
| 192 | Ga0466705_527441 | 3300042612 | Bacteria | 2255 |
| 193 | Ga0466711_083216 | 3300042615 | Bacteria | 2075 |
| 194 | Ga0466711_320221 | 3300042615 | Bacteria | 12786 |
| 195 | Ga0466718_007691 | 3300042617 | Bacteria | 7899 |
| 196 | Ga0466723_248468 | 3300042618 | Bacteria | 4384 |
| 197 | Ga0466728_472777 | 3300042620 | Bacteria | 5468 |
| 198 | Ga0466713_042040 | 3300042602 | Bacteria | 3069 |
| 199 | Ga0466716_125474 | 3300042605 | Bacteria | 40593 |
| 200 | Ga0466716_459383 | 3300042605 | Bacteria | 11036 |
| 201 | Ga0466735_029444 | 3300042624 | Bacteria | 1848 |
| 202 | Ga0466703_120496 | 3300042636 | Bacteria | 11438 |
| 203 | Ga0466703_250055 | 3300042636 | Bacteria | 2562 |
| 204 | Ga0466704_136878 | 3300042643 | Bacteria | 8829 |
| 205 | Ga0466709_104823 | 3300042648 | Bacteria | 1910 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02421 | GO:0005525 | GTP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.