Protein Family IF07026
Metagenome
Metatranscriptome
Isolate
278
Members
62
Samples
275
Scaffolds
394.97
Avg Length
Representative Sequence
- ID
- 3300042611|Ga0466697_262959|Ga0466697_262959_67_1491
- Length
- 474 aa
- Sequence
- MDRYAGYCGTPIFIADRGMSSYNCYAHAVENGVFFIIRTKDLNIQRLLGVRISSQITYPNRQIHGILFSLSGRGGNGIMEERILTMLPYLNEAQKRLFLASEAIAYGRGGISETERISGVSRKTIRKGIAEIRSGKTPSERIRSGGGGRKSIETTHPNIEDEIRRLVDGSTYGDPERVLSYTTESLRKIENELKNRGIQIGRTAISKILNSMGYSKQTNQKMLQVGEPHPDRNAQFEHINKIASEYLVAGNPVISVDTKKKENIGNFKNNGQEYRQNNDPRKVLDHDFPIKELGKISPYGVYNLNNNTGFVNVGTSHDTSEFAVESISRWWESVGKHTFPASSKIFITCDSGGSNGYRVRMWKYQLQQFANRTGLEIEVSHFPRGTSKWNKIEHRLFCYISKNWQGKPLVDVQTAVDLIGATKTNAGLKVICVRDDTEYKLARKISDEEFLTINIDKIKPFEAWNYKISPARNG
Sample Types
Isolate
1.1%
Metagenome
98.6%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
61.0%
Kalotermitidae
23.7%
Unclassified
6.8%
Termopsidae
6.8%
Rhinotermitidae
1.7%
Taxonomy
Archaea
6
Bacteria
205
Eukaryota
0
Viruses
0
Unclassified
67
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 26 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 27 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 28 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 29 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 30 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 38 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 39 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 40 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 41 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 42 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 46 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 51 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 52 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 53 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 56 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 57 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 60 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 61 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 62 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_095295 | 3300042611 | Bacteria | 1505 |
| 2 | Ga0466705_152055 | 3300042612 | Bacteria | 6653 |
| 3 | Ga0466733_023279 | 3300042659 | Archaea | 1556 |
| 4 | Ga0466710_314381 | 3300042613 | Bacteria | 1443 |
| 5 | Ga0466710_340598 | 3300042613 | Bacteria | 1331 |
| 6 | Ga0466711_056015 | 3300042615 | Bacteria | 4500 |
| 7 | Ga0255809_1033859 | 3300022820 | Bacteria | 1391 |
| 8 | Ga0466657_144026 | 3300042582 | Bacteria | 1475 |
| 9 | Ga0466693_147538 | 3300042592 | Bacteria | 1423 |
| 10 | Ga0466691_068053 | 3300042593 | Archaea | 1921 |
| 11 | Ga0466691_212128 | 3300042593 | Unclassified | 1436 |
| 12 | Ga0466694_223709 | 3300042594 | Archaea | 2039 |
| 13 | Ga0466696_100396 | 3300042596 | Bacteria | 2046 |
| 14 | Ga0466696_230689 | 3300042596 | Unclassified | 1964 |
| 15 | Ga0466707_201777 | 3300042601 | Bacteria | 1607 |
| 16 | Ga0466698_065370 | 3300042610 | Bacteria | 1938 |
| 17 | Ga0466698_425062 | 3300042610 | Bacteria | 1494 |
| 18 | Ga0466698_477722 | 3300042610 | Unclassified | 1467 |
| 19 | Ga0123355_10514610 | 3300009826 | Unclassified | 1468 |
| 20 | Ga0123356_10300150 | 3300010049 | Bacteria | 1711 |
| 21 | Ga0123356_10467644 | 3300010049 | Bacteria | 1412 |
| 22 | Ga0123353_10130828 | 3300010167 | Bacteria | 4027 |
| 23 | JGI24695J34938_10074016 | 3300002450 | Bacteria | 1418 |
| 24 | JGI24703J35330_11576224 | 3300002501 | Bacteria | 1296 |
| 25 | JGI24705J35276_12175352 | 3300002504 | Bacteria | 1324 |
| 26 | Ga0068302_10024395 | 3300005071 | Bacteria | 1316 |
| 27 | Ga0072941_1250057 | 3300005201 | Bacteria | 1408 |
| 28 | Ga0466731_003091 | 3300042622 | Unclassified | 1028 |
| 29 | Ga0466731_090863 | 3300042622 | Bacteria | 1380 |
| 30 | Ga0466734_044203 | 3300042623 | Bacteria | 1869 |
| 31 | Ga0466702_137056 | 3300042635 | Bacteria | 1465 |
| 32 | Ga0466702_293948 | 3300042635 | Bacteria | 1381 |
| 33 | Ga0466704_036157 | 3300042643 | Bacteria | 27924 |
| 34 | Ga0466704_160013 | 3300042643 | Unclassified | 2141 |
| 35 | Ga0466725_466091 | 3300042654 | Bacteria | 1673 |
| 36 | Ga0466705_057144 | 3300042612 | Bacteria | 4029 |
| 37 | Ga0466732_072932 | 3300042656 | Unclassified | 2555 |
| 38 | Ga0466733_019362 | 3300042659 | Bacteria | 1710 |
| 39 | Ga0466733_073934 | 3300042659 | Bacteria | 2251 |
| 40 | Ga0466705_471134 | 3300042612 | Bacteria | 1445 |
| 41 | Ga0466718_078778 | 3300042617 | Bacteria | 1311 |
| 42 | Ga0466728_136644 | 3300042620 | Bacteria | 3976 |
| 43 | Ga0466694_082882 | 3300042594 | Bacteria | 2311 |
| 44 | Ga0466696_441914 | 3300042596 | Bacteria | 2986 |
| 45 | Ga0466699_138809 | 3300042597 | Bacteria | 2012 |
| 46 | Ga0466700_295916 | 3300042600 | Bacteria | 1774 |
| 47 | Ga0466700_334043 | 3300042600 | Bacteria | 2689 |
| 48 | Ga0466700_425552 | 3300042600 | Bacteria | 1708 |
| 49 | Ga0466717_044250 | 3300042604 | Bacteria | 1663 |
| 50 | Ga0466717_095273 | 3300042604 | Bacteria | 1529 |
| 51 | Ga0466719_477163 | 3300042606 | Bacteria | 2855 |
| 52 | Ga0466720_004914 | 3300042607 | Unclassified | 1932 |
| 53 | Ga0466698_347790 | 3300042610 | Bacteria | 1585 |
| 54 | Ga0123357_10304108 | 3300009784 | Unclassified | 1605 |
| 55 | Ga0123357_10379505 | 3300009784 | Unclassified | 1314 |
| 56 | Ga0123356_10263650 | 3300010049 | Bacteria | 1808 |
| 57 | Ga0123356_10270944 | 3300010049 | Unclassified | 1787 |
| 58 | JGI24702J35022_10153415 | 3300002462 | Unclassified | 1293 |
| 59 | JGI24705J35276_12236645 | 3300002504 | Bacteria | 8513 |
| 60 | Ga0466735_103368 | 3300042624 | Bacteria | 1621 |
| 61 | Ga0466704_032755 | 3300042643 | Bacteria | 5402 |
| 62 | Ga0466704_366438 | 3300042643 | Unclassified | 1498 |
| 63 | Ga0466727_081163 | 3300042655 | Bacteria | 1416 |
| 64 | Ga0466727_155065 | 3300042655 | Bacteria | 1782 |
| 65 | Ga0466705_136738 | 3300042612 | Bacteria | 1801 |
| 66 | Ga0466732_320014 | 3300042656 | Unclassified | 1869 |
| 67 | Ga0466733_147975 | 3300042659 | Bacteria | 1525 |
| 68 | Ga0466710_110771 | 3300042613 | Unclassified | 1511 |
| 69 | Ga0466710_261755 | 3300042613 | Bacteria | 1629 |
| 70 | Ga0466711_217240 | 3300042615 | Bacteria | 2129 |
| 71 | Ga0466715_145735 | 3300042616 | Bacteria | 1901 |
| 72 | Ga0466715_201436 | 3300042616 | Bacteria | 2187 |
| 73 | Ga0466726_468146 | 3300042619 | Unclassified | 1858 |
| 74 | Ga0466728_138095 | 3300042620 | Bacteria | 1493 |
| 75 | Ga0466728_199118 | 3300042620 | Bacteria | 2343 |
| 76 | Ga0466728_281924 | 3300042620 | Bacteria | 2287 |
| 77 | Ga0415639_177011 | 3300038395 | Bacteria | 2049 |
| 78 | Ga0415639_253265 | 3300038395 | Unclassified | 1367 |
| 79 | Ga0466656_038977 | 3300042550 | Bacteria | 1341 |
| 80 | Ga0466693_114921 | 3300042592 | Bacteria | 1472 |
| 81 | Ga0466693_156603 | 3300042592 | Unclassified | 2467 |
| 82 | Ga0466693_220137 | 3300042592 | Bacteria | 1597 |
| 83 | Ga0466694_167066 | 3300042594 | Bacteria | 4459 |
| 84 | Ga0466695_363679 | 3300042595 | Bacteria | 1699 |
| 85 | Ga0466699_038972 | 3300042597 | Bacteria | 1397 |
| 86 | Ga0466701_062565 | 3300042598 | Bacteria | 1505 |
| 87 | Ga0466700_365745 | 3300042600 | Unclassified | 1505 |
| 88 | Ga0466714_092523 | 3300042603 | Unclassified | 1595 |
| 89 | Ga0466716_042446 | 3300042605 | Bacteria | 2277 |
| 90 | Ga0466719_240887 | 3300042606 | Bacteria | 2407 |
| 91 | Ga0466719_327943 | 3300042606 | Unclassified | 1812 |
| 92 | Ga0466719_513337 | 3300042606 | Bacteria | 1715 |
| 93 | Ga0123357_10282889 | 3300009784 | Bacteria | 1710 |
| 94 | Ga0123355_10541796 | 3300009826 | Bacteria | 1412 |
| 95 | Ga0123353_10429651 | 3300010167 | Bacteria | 1954 |
| 96 | Ga0123354_10213080 | 3300010882 | Bacteria | 2080 |
| 97 | Ga0466729_228428 | 3300042621 | Bacteria | 1743 |
| 98 | Ga0466731_115565 | 3300042622 | Bacteria | 1413 |
| 99 | Ga0466731_220746 | 3300042622 | Bacteria | 1529 |
| 100 | Ga0466734_118497 | 3300042623 | Unclassified | 1506 |
| 101 | Ga0466702_152059 | 3300042635 | Bacteria | 1584 |
| 102 | Ga0466709_339397 | 3300042648 | Bacteria | 2162 |
| 103 | Ga0466724_05373 | 3300042649 | Bacteria | 1618 |
| 104 | Ga0466727_029604 | 3300042655 | Bacteria | 3157 |
| 105 | Ga0466697_256595 | 3300042611 | Unclassified | 1514 |
| 106 | Ga0466705_061867 | 3300042612 | Bacteria | 10725 |
| 107 | Ga0466705_073634 | 3300042612 | Bacteria | 22844 |
| 108 | Ga0466733_204043 | 3300042659 | Bacteria | 2203 |
| 109 | Ga0466733_216861 | 3300042659 | Bacteria | 1895 |
| 110 | Ga0466705_460643 | 3300042612 | Bacteria | 2305 |
| 111 | Ga0466710_147163 | 3300042613 | Bacteria | 1600 |
| 112 | Ga0466711_367836 | 3300042615 | Bacteria | 1868 |
| 113 | Ga0466723_008274 | 3300042618 | Bacteria | 6115 |
| 114 | Ga0466726_243217 | 3300042619 | Bacteria | 2162 |
| 115 | Ga0466726_410598 | 3300042619 | Bacteria | 1548 |
| 116 | Ga0466728_145995 | 3300042620 | Bacteria | 1474 |
| 117 | Ga0264413_153005 | 3300024493 | Unclassified | 1363 |
| 118 | Ga0466693_247182 | 3300042592 | Bacteria | 1853 |
| 119 | Ga0466693_345413 | 3300042592 | Bacteria | 2592 |
| 120 | Ga0466691_203894 | 3300042593 | Bacteria | 22141 |
| 121 | Ga0466694_239754 | 3300042594 | Unclassified | 1550 |
| 122 | Ga0466696_238994 | 3300042596 | Bacteria | 3596 |
| 123 | Ga0466699_203409 | 3300042597 | Bacteria | 1485 |
| 124 | Ga0466700_325023 | 3300042600 | Unclassified | 1786 |
| 125 | Ga0466700_391478 | 3300042600 | Bacteria | 1663 |
| 126 | Ga0466719_114831 | 3300042606 | Bacteria | 1894 |
| 127 | Ga0466719_546200 | 3300042606 | Bacteria | 2167 |
| 128 | Ga0466721_108437 | 3300042608 | Bacteria | 1677 |
| 129 | Ga0466697_005450 | 3300042611 | Bacteria | 1497 |
| 130 | Ga0123355_10359307 | 3300009826 | Unclassified | 1920 |
| 131 | Ga0123356_10400914 | 3300010049 | Bacteria | 1509 |
| 132 | Ga0123353_10421892 | 3300010167 | Bacteria | 1976 |
| 133 | Ga0123353_10760735 | 3300010167 | Bacteria | 1346 |
| 134 | JGI24695J34938_10051702 | 3300002450 | Bacteria | 1796 |
| 135 | Ga0466731_111697 | 3300042622 | Unclassified | 1311 |
| 136 | Ga0466731_266136 | 3300042622 | Unclassified | 2308 |
| 137 | Ga0466725_388103 | 3300042654 | Bacteria | 2001 |
| 138 | Ga0466697_186311 | 3300042611 | Unclassified | 3191 |
| 139 | Ga0466705_147075 | 3300042612 | Bacteria | 2506 |
| 140 | Ga0466732_212230 | 3300042656 | Unclassified | 1563 |
| 141 | Ga0466733_107088 | 3300042659 | Bacteria | 1468 |
| 142 | Ga0466733_208245 | 3300042659 | Unclassified | 1462 |
| 143 | Ga0466705_438046 | 3300042612 | Unclassified | 1625 |
| 144 | Ga0466715_527694 | 3300042616 | Archaea | 1683 |
| 145 | Ga0466718_146439 | 3300042617 | Bacteria | 1633 |
| 146 | Ga0466728_188569 | 3300042620 | Bacteria | 1552 |
| 147 | Ga0265387_1006872 | 3300024582 | Bacteria | 1525 |
| 148 | Ga0415639_035369 | 3300038395 | Bacteria | 1822 |
| 149 | Ga0415639_086605 | 3300038395 | Bacteria | 1399 |
| 150 | Ga0466693_200956 | 3300042592 | Bacteria | 1449 |
| 151 | Ga0466693_389311 | 3300042592 | Unclassified | 1381 |
| 152 | Ga0466694_148687 | 3300042594 | Unclassified | 1425 |
| 153 | Ga0466700_279190 | 3300042600 | Bacteria | 1461 |
| 154 | Ga0466707_010259 | 3300042601 | Bacteria | 1293 |
| 155 | Ga0466714_118979 | 3300042603 | Bacteria | 2195 |
| 156 | Ga0466719_110231 | 3300042606 | Bacteria | 1698 |
| 157 | Ga0466719_225220 | 3300042606 | Bacteria | 1963 |
| 158 | Ga0466721_324161 | 3300042608 | Unclassified | 1620 |
| 159 | Ga0123355_10472661 | 3300009826 | Unclassified | 1565 |
| 160 | Ga0123355_10507718 | 3300009826 | Bacteria | 1483 |
| 161 | Ga0123356_10356341 | 3300010049 | Bacteria | 1588 |
| 162 | Ga0123356_10413626 | 3300010049 | Bacteria | 1489 |
| 163 | Ga0123353_10485023 | 3300010167 | Bacteria | 1807 |
| 164 | Ga0123354_10255603 | 3300010882 | Bacteria | 1763 |
| 165 | Ga0123354_10288073 | 3300010882 | Bacteria | 1580 |
| 166 | JGI24695J34938_10085720 | 3300002450 | Unclassified | 1297 |
| 167 | JGI24703J35330_11615838 | 3300002501 | Bacteria | 1431 |
| 168 | Ga0466731_045304 | 3300042622 | Bacteria | 1430 |
| 169 | Ga0466731_145518 | 3300042622 | Bacteria | 1467 |
| 170 | Ga0466731_370664 | 3300042622 | Bacteria | 1522 |
| 171 | Ga0466734_060590 | 3300042623 | Unclassified | 2517 |
| 172 | Ga0466702_247692 | 3300042635 | Bacteria | 1751 |
| 173 | Ga0466704_176210 | 3300042643 | Unclassified | 1618 |
| 174 | Ga0466724_44260 | 3300042649 | Bacteria | 1526 |
| 175 | Ga0466708_423946 | 3300042652 | Bacteria | 1879 |
| 176 | Ga0466725_237473 | 3300042654 | Bacteria | 2122 |
| 177 | Ga0466697_231933 | 3300042611 | Bacteria | 1628 |
| 178 | Ga0466697_262959 | 3300042611 | Bacteria | 1505 |
| 179 | Ga0466705_084996 | 3300042612 | Bacteria | 36977 |
| 180 | Ga0466732_139785 | 3300042656 | Bacteria | 1425 |
| 181 | Ga0466710_018632 | 3300042613 | Bacteria | 1524 |
| 182 | Ga0466711_192351 | 3300042615 | Bacteria | 1287 |
| 183 | Ga0466723_156488 | 3300042618 | Bacteria | 4275 |
| 184 | Ga0466726_226972 | 3300042619 | Bacteria | 1977 |
| 185 | Ga0415639_023487 | 3300038395 | Unclassified | 1290 |
| 186 | Ga0466656_218602 | 3300042550 | Unclassified | 1662 |
| 187 | Ga0466656_290851 | 3300042550 | Bacteria | 1479 |
| 188 | Ga0466656_383412 | 3300042550 | Bacteria | 1441 |
| 189 | Ga0466693_230889 | 3300042592 | Bacteria | 1447 |
| 190 | Ga0466691_219078 | 3300042593 | Unclassified | 1152 |
| 191 | Ga0466701_048509 | 3300042598 | Bacteria | 1528 |
| 192 | Ga0466717_309847 | 3300042604 | Unclassified | 1418 |
| 193 | Ga0466698_229238 | 3300042610 | Unclassified | 1690 |
| 194 | Ga0123355_10435262 | 3300009826 | Unclassified | 1665 |
| 195 | Ga0123356_10121952 | 3300010049 | Bacteria | 2537 |
| 196 | JGI24695J34938_10082581 | 3300002450 | Unclassified | 1326 |
| 197 | JGI24702J35022_10151896 | 3300002462 | Bacteria | 1300 |
| 198 | Ga0072941_1333041 | 3300005201 | Bacteria | 1287 |
| 199 | Ga0466731_340930 | 3300042622 | Bacteria | 1617 |
| 200 | Ga0466731_353429 | 3300042622 | Bacteria | 1636 |
| 201 | Ga0466734_010276 | 3300042623 | Bacteria | 1487 |
| 202 | Ga0466734_087428 | 3300042623 | Bacteria | 1698 |
| 203 | Ga0466704_240941 | 3300042643 | Bacteria | 2484 |
| 204 | Ga0466704_396301 | 3300042643 | Unclassified | 2242 |
| 205 | Ga0466725_363541 | 3300042654 | Bacteria | 2252 |
| 206 | Ga0466732_015550 | 3300042656 | Unclassified | 2087 |
| 207 | Ga0466733_066976 | 3300042659 | Bacteria | 2197 |
| 208 | Ga0466712_219146 | 3300042614 | Unclassified | 1365 |
| 209 | Ga0466656_233459 | 3300042550 | Bacteria | 1616 |
| 210 | Ga0466657_113113 | 3300042582 | Bacteria | 1602 |
| 211 | Ga0466690_067257 | 3300042590 | Bacteria | 2055 |
| 212 | Ga0466694_050960 | 3300042594 | Bacteria | 1698 |
| 213 | Ga0466696_023268 | 3300042596 | Bacteria | 3438 |
| 214 | Ga0466696_068266 | 3300042596 | Bacteria | 1540 |
| 215 | Ga0466696_329734 | 3300042596 | Bacteria | 1581 |
| 216 | Ga0466699_430881 | 3300042597 | Unclassified | 1690 |
| 217 | Ga0466700_122265 | 3300042600 | Unclassified | 1499 |
| 218 | Ga0466700_138832 | 3300042600 | Bacteria | 1288 |
| 219 | Ga0466700_183541 | 3300042600 | Bacteria | 1511 |
| 220 | Ga0466700_293945 | 3300042600 | Bacteria | 1575 |
| 221 | Ga0466700_336271 | 3300042600 | Bacteria | 1706 |
| 222 | Ga0466700_407305 | 3300042600 | Bacteria | 1620 |
| 223 | Ga0466700_441714 | 3300042600 | Unclassified | 1388 |
| 224 | Ga0466714_057320 | 3300042603 | Bacteria | 2015 |
| 225 | Ga0466717_002423 | 3300042604 | Bacteria | 1576 |
| 226 | Ga0466717_171854 | 3300042604 | Bacteria | 2243 |
| 227 | Ga0466717_198656 | 3300042604 | Archaea | 1444 |
| 228 | Ga0466719_516237 | 3300042606 | Unclassified | 1269 |
| 229 | Ga0466720_015265 | 3300042607 | Unclassified | 1513 |
| 230 | Ga0466721_398009 | 3300042608 | Unclassified | 8656 |
| 231 | Ga0466698_317035 | 3300042610 | Bacteria | 1475 |
| 232 | Ga0466698_340158 | 3300042610 | Bacteria | 1471 |
| 233 | Ga0123355_10051960 | 3300009826 | Bacteria | 6650 |
| 234 | Ga0123355_10425410 | 3300009826 | Unclassified | 1694 |
| 235 | Ga0123355_10451983 | 3300009826 | Bacteria | 1618 |
| 236 | Ga0123356_10370235 | 3300010049 | Bacteria | 1562 |
| 237 | Ga0123356_10458878 | 3300010049 | Unclassified | 1424 |
| 238 | Ga0123353_10721542 | 3300010167 | Bacteria | 1394 |
| 239 | Ga0123354_10276561 | 3300010882 | Bacteria | 1640 |
| 240 | JGI24695J34938_10068558 | 3300002450 | Bacteria | 1489 |
| 241 | JGI24702J35022_10030074 | 3300002462 | Unclassified | 2913 |
| 242 | Ga0068302_10146898 | 3300005071 | Bacteria | 1459 |
| 243 | Ga0466731_365944 | 3300042622 | Bacteria | 1475 |
| 244 | Ga0466703_308515 | 3300042636 | Bacteria | 1362 |
| 245 | Ga0466704_532717 | 3300042643 | Archaea | 1488 |
| 246 | Ga0466705_280130 | 3300042612 | Bacteria | 2123 |
| 247 | Ga0466705_385895 | 3300042612 | Bacteria | 3409 |
| 248 | Ga0466712_107656 | 3300042614 | Unclassified | 2593 |
| 249 | Ga0415639_144018 | 3300038395 | Unclassified | 2046 |
| 250 | Ga0466693_265280 | 3300042592 | Bacteria | 1259 |
| 251 | Ga0466694_012303 | 3300042594 | Bacteria | 2001 |
| 252 | Ga0466694_102428 | 3300042594 | Bacteria | 1676 |
| 253 | Ga0466694_265548 | 3300042594 | Unclassified | 1815 |
| 254 | Ga0466699_168539 | 3300042597 | Unclassified | 2147 |
| 255 | Ga0466701_066040 | 3300042598 | Bacteria | 1435 |
| 256 | Ga0466714_142428 | 3300042603 | Bacteria | 1954 |
| 257 | Ga0466714_145217 | 3300042603 | Bacteria | 1808 |
| 258 | Ga0466719_328131 | 3300042606 | Bacteria | 2111 |
| 259 | Ga0466720_003430 | 3300042607 | Bacteria | 2596 |
| 260 | Ga0466721_359178 | 3300042608 | Bacteria | 2085 |
| 261 | Ga0466698_130794 | 3300042610 | Unclassified | 2537 |
| 262 | Ga0123357_10289965 | 3300009784 | Bacteria | 1673 |
| 263 | Ga0123355_10601848 | 3300009826 | Bacteria | 1304 |
| 264 | Ga0123356_10106588 | 3300010049 | Unclassified | 2699 |
| 265 | Ga0123356_10149433 | 3300010049 | Bacteria | 2317 |
| 266 | Ga0123356_10411859 | 3300010049 | Bacteria | 1491 |
| 267 | Ga0123356_10432743 | 3300010049 | Bacteria | 1460 |
| 268 | Ga0123356_10569408 | 3300010049 | Unclassified | 1295 |
| 269 | Ga0123353_10476574 | 3300010167 | Bacteria | 1828 |
| 270 | Ga0123354_10078386 | 3300010882 | Unclassified | 4697 |
| 271 | JGI24695J34938_10053310 | 3300002450 | Bacteria | 1760 |
| 272 | JGI24696J40584_12916940 | 3300002834 | Bacteria | 1307 |
| 273 | Ga0466731_101798 | 3300042622 | Bacteria | 2275 |
| 274 | Ga0466725_180546 | 3300042654 | Bacteria | 1633 |
| 275 | Ga0466725_314562 | 3300042654 | Bacteria | 1542 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07592 | DDE_Tnp_ISAZ013 | Rhodopirellula transposase DDE domain | 163 | 470 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.