Protein Family IF07006

Metagenome Isolate
156 Members
69 Samples
126 Scaffolds
416.03 Avg Length

🧬 Representative Sequence

ID
3300042611|Ga0466697_148765|Ga0466697_148765_183_1598
Length
471 aa
Sequence
LSTDAHGGGGLSRISEEVAVMAMERRGWLILVICFEQLIFFFFRMNQEQINKPFSIPKHLIFNAWEGVKENRGSAGIDTVSLKDYEKSLGNNLYKLWNRMSSGSYFPSSVKLVEIPKKTGGKRPLGIPTVEDRIAQNAVVLHIADRLDKEFHKDSYAYRPGRNAIDALSSARVRCWQYDWVLDMDISKFFDTINHDLLMRAVHCHVTEKWILLYIERWLKVPYETSSGERIERSMGVPQGSVIGPVLANLFMHYVFDKWMQIHYPQIPFERYADDTICHCRTQSEAEQMRVIIMNRLSVCGLKLNEEKTRIVYCKDSNRKENQEVISFDFLGFTFRPRKVKSKHGKVFTGFTSGISQKSKNHIHDTLRGWQLIRKRDLIEIDSQMHASVCGWINYYGKFNRDSLKSTLQSLNHAIVRWAVRKYKRLKGSFKRGWYWLIRVYQKNPKTFYHWCRGIIPCYFKLKPVKVRRAV

📊 Sample Types

Isolate 19.2%
Metagenome 80.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 47.8%
Kalotermitidae 16.4%
Culicidae 6.0%
Blattidae 4.5%
Termopsidae 4.5%
Ixodidae 3.0%
Rhinotermitidae 3.0%
Hodotermitidae 1.5%
Drosophilidae 1.5%
Passalidae 1.5%
Delphacidae 1.5%
Unclassified 1.5%
Formicidae 1.5%
Cylisticidae 1.5%
Tenebrionidae 1.5%
Pulicidae 1.5%
Silvanidae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 151
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300002732 Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs Metagenome
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
8 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
9 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
12 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
13 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
14 2896342394 Wolbachia endosymbiont of Nilaparvata lugens wLug Isolate Delphacidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
19 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
20 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
21 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
22 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
23 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
24 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
25 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
26 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
27 2588253760 Wolbachia endosymbiont wPip_Mol of Culex molestus Isolate Culicidae
28 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
29 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
30 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
31 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
35 647533204 Rickettsia endosymbiont of Ixodes scapularis Isolate Ixodidae
36 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
37 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
38 2846025955 Wolbachia endosymbiont of Cylisticus convexus Wcon Isolate Cylisticidae
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
41 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
42 642979308 Wolbachia endosymbiont of Culex quinquefasciatus JHB Isolate Culicidae
43 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
47 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
48 2884843004 Wolbachia endosymbiont of Ctenocephalides felis wCfeT Isolate Pulicidae
49 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
50 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
51 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
52 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
53 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
54 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
55 2582581025 Rickettsia tamurae buchneri ISO7 Isolate Ixodidae
56 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
57 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
58 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
59 2840666718 Wolbachia pipientis wAlbB Isolate Culicidae
60 2993991113 Shikimatogenerans silvanidophilus JKI-2014 Isolate Silvanidae
61 3004667792 Bacteroides sp. 519 Isolate Blattidae
62 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
63 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
64 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
65 642555168 Wolbachia endosymbiont of Culex quinquefasciatus Pel Isolate Culicidae
66 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
67 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
68 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
69 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_207778 3300042659 Bacteria 1869
2 Ga0466693_307240 3300042592 Bacteria 4798
3 Ga0466694_142541 3300042594 Bacteria 3341
4 Ga0466694_341285 3300042594 Unclassified 3726
5 Ga0466696_020740 3300042596 Bacteria 2382
6 Ga0466706_153622 3300042599 Bacteria 2191
7 Ga0466714_030102 3300042603 Bacteria 2205
8 2227098058 2225789004 Bacteria 1805
9 JGI24700J35501_10930851 3300002508 Bacteria 28250
10 Ga0072940_1093091 3300005200 Bacteria 1871
11 Ga0072941_1243424 3300005201 Bacteria 1925
12 Ga0466711_453048 3300042615 Bacteria 5856
13 Ga0466704_054505 3300042643 Bacteria 1840
14 Ga0123354_10154999 3300010882 Bacteria 2753
15 Ga0466697_148765 3300042611 Bacteria 2075
16 Ga0466705_006559 3300042612 Bacteria 5623
17 Ga0415639_186393 3300038395 Bacteria 1889
18 Ga0466690_079947 3300042590 Bacteria 1449
19 Ga0466694_207609 3300042594 Bacteria 2030
20 Ga0466717_084571 3300042604 Bacteria 2177
21 JGI24705J35276_12213714 3300002504 Bacteria 1934
22 WW0001_100179 3300002732 Bacteria 1870
23 Ga0466705_521167 3300042612 Bacteria 1975
24 Ga0466711_276593 3300042615 Bacteria 2077
25 Ga0466734_142482 3300042623 Bacteria 2541
26 Ga0466735_173263 3300042624 Bacteria 2043
27 Ga0466702_030919 3300042635 Bacteria 2140
28 Ga0466704_384121 3300042643 Bacteria 2243
29 Ga0466724_58263 3300042649 Bacteria 1233
30 Ga0466725_239115 3300042654 Bacteria 1949
31 Ga0123356_10055473 3300010049 Bacteria 3691
32 Ga0123356_10165490 3300010049 Bacteria 2215
33 Ga0466705_217909 3300042612 Bacteria 2317
34 Ga0466656_172657 3300042550 Bacteria 1946
35 Ga0466693_124386 3300042592 Bacteria 2474
36 Ga0466693_254079 3300042592 Bacteria 1648
37 Ga0466700_090102 3300042600 Bacteria 2153
38 Ga0466700_211428 3300042600 Bacteria 2279
39 Ga0466722_082567 3300042609 Bacteria 1917
40 JGI24696J40584_12947911 3300002834 Bacteria 1975
41 Ga0466718_098045 3300042617 Bacteria 2208
42 Ga0466729_194403 3300042621 Bacteria 2250
43 Ga0466731_186676 3300042622 Bacteria 2226
44 Ga0466703_408980 3300042636 Bacteria 2020
45 Ga0466703_417527 3300042636 Bacteria 2110
46 Ga0466704_554713 3300042643 Bacteria 2695
47 Ga0466709_221860 3300042648 Bacteria 264751
48 Ga0466709_396735 3300042648 Bacteria 2793
49 Ga0466725_270282 3300042654 Bacteria 2071
50 Ga0123353_10317283 3300010167 Bacteria 2367
51 Ga0466656_258200 3300042550 Bacteria 20326
52 Ga0466693_079380 3300042592 Bacteria 2002
53 Ga0466701_098305 3300042598 Bacteria 30502
54 Ga0466719_243777 3300042606 Bacteria 2229
55 Ga0466698_452719 3300042610 Bacteria 2845
56 Ga0466697_056626 3300042611 Bacteria 5314
57 2227206095 2225789004 Bacteria 1425
58 Ga0466711_022585 3300042615 Bacteria 7217
59 Ga0466715_279588 3300042616 Bacteria 2768
60 Ga0466726_364364 3300042619 Bacteria 1368
61 Ga0466703_185270 3300042636 Bacteria 4476
62 Ga0466709_191668 3300042648 Bacteria 3118
63 Ga0123357_10080351 3300009784 Bacteria 4289
64 Ga0415639_082201 3300038395 Bacteria 2455
65 Ga0466717_012167 3300042604 Bacteria 1553
66 JGI24702J35022_10081242 3300002462 Bacteria 1756
67 Ga0466705_437945 3300042612 Bacteria 2693
68 Ga0466710_075814 3300042613 Bacteria 2761
69 Ga0466711_158449 3300042615 Bacteria 2001
70 Ga0123357_10202654 3300009784 Bacteria 2253
71 Ga0123355_10484705 3300009826 Bacteria 1536
72 Ga0123356_10049225 3300010049 Bacteria 3923
73 Ga0123356_10151727 3300010049 Bacteria 2301
74 Ga0123356_10177800 3300010049 Bacteria 2146
75 Ga0123353_10287535 3300010167 Bacteria 2519
76 Ga0123354_10168472 3300010882 Bacteria 2562
77 Ga0415639_131534 3300038395 Bacteria 2709
78 Ga0466695_191493 3300042595 Bacteria 2313
79 Ga0466701_057409 3300042598 Bacteria 1671
80 Ga0466700_440813 3300042600 Unclassified 2442
81 Ga0466721_118289 3300042608 Bacteria 1777
82 Ga0466697_025773 3300042611 Bacteria 3359
83 JGI24702J35022_10017597 3300002462 Bacteria 3904
84 JGI24703J35330_11673238 3300002501 Bacteria 1746
85 Ga0104048_1021570 3300007143 Bacteria 4803
86 Ga0466731_085208 3300042622 Bacteria 1774
87 Ga0466727_280105 3300042655 Bacteria 1889
88 Ga0123355_10136296 3300009826 Bacteria 3769
89 Ga0123356_10194628 3300010049 Bacteria 2062
90 Ga0123353_10414995 3300010167 Bacteria 1997
91 Ga0466697_147254 3300042611 Bacteria 1610
92 Ga0562375_0075 3300056856 Bacteria 335455
93 Ga0415639_063082 3300038395 Unclassified 2274
94 Ga0415639_074974 3300038395 Bacteria 2961
95 Ga0466691_045556 3300042593 Bacteria 17407
96 Ga0466701_089560 3300042598 Bacteria 1837
97 Ga0466700_323983 3300042600 Bacteria 2808
98 Ga0466716_281311 3300042605 Bacteria 1750
99 Ga0466721_388772 3300042608 Bacteria 2123
100 2227631034 2225789004 Bacteria 2122
101 JGI24695J34938_10029735 3300002450 Bacteria 2552
102 Ga0103260_1005170 3300007139 Bacteria 1937
103 Ga0466705_436874 3300042612 Bacteria 2295
104 Ga0466718_075312 3300042617 Bacteria 2056
105 Ga0466729_080064 3300042621 Bacteria 2863
106 Ga0466703_012180 3300042636 Unclassified 8137
107 Ga0466725_138977 3300042654 Bacteria 2278
108 Ga0466727_219975 3300042655 Bacteria 2425
109 Ga0123356_10141969 3300010049 Bacteria 2370
110 Ga0466697_115914 3300042611 Bacteria 2502
111 Ga0466693_350356 3300042592 Bacteria 2849
112 Ga0466691_002249 3300042593 Bacteria 6834
113 Ga0466695_278213 3300042595 Bacteria 1547
114 Ga0466700_231621 3300042600 Bacteria 1574
115 Ga0466717_304042 3300042604 Bacteria 1560
116 Ga0466716_544849 3300042605 Unclassified 2185
117 Ga0466721_291371 3300042608 Bacteria 2634
118 Ga0466722_068893 3300042609 Bacteria 40868
119 Ga0466705_501515 3300042612 Bacteria 1996
120 Ga0466718_122502 3300042617 Bacteria 2425
121 Ga0466731_141469 3300042622 Bacteria 1776
122 Ga0466734_072814 3300042623 Bacteria 1648
123 Ga0466703_354883 3300042636 Bacteria 5995
124 Ga0466725_297744 3300042654 Bacteria 2413
125 Ga0123353_10274617 3300010167 Bacteria 2594
126 Ga0123353_10289637 3300010167 Bacteria 2508

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042621 Ga0466729_080064 Ga0466729_080064_1041_2090 349
2 3300042649 Ga0466724_58263 Ga0466724_58263_58_1140 360
3 3300038395 Ga0415639_063082 Ga0415639_063082_789_1877 362
4 3300042619 Ga0466726_364364 Ga0466726_364364_186_1277 363
5 3300042604 Ga0466717_304042 Ga0466717_304042_97_1197 366
6 3300042648 Ga0466709_191668 Ga0466709_191668_56_1174 372
7 3300042612 Ga0466705_217909 Ga0466705_217909_445_1566 373
8 iso_pr_bacteria 2582581025 2584319616 377
9 iso_pr_bacteria 3004667792 3004671611 391
10 3300042612 Ga0466705_501515 Ga0466705_501515_131_1336 396
11 3300042615 Ga0466711_276593 Ga0466711_276593_45_1235 396
12 3300042590 Ga0466690_079947 Ga0466690_079947_213_1406 397
13 3300042612 Ga0466705_521167 Ga0466705_521167_516_1709 397
14 3300042605 Ga0466716_544849 Ga0466716_544849_673_1878 401
15 3300042636 Ga0466703_354883 Ga0466703_354883_80_1285 401
16 3300042643 Ga0466704_054505 Ga0466704_054505_609_1814 401
17 3300042655 Ga0466727_219975 Ga0466727_219975_543_1748 401
18 iso_pr_bacteria 2582581025 2584320370 401
19 3300042623 Ga0466734_142482 Ga0466734_142482_1070_2329 403
20 3300042550 Ga0466656_172657 Ga0466656_172657_528_1796 404
21 3300042609 Ga0466722_068893 Ga0466722_068893_821_2089 404
22 3300042617 Ga0466718_098045 Ga0466718_098045_630_1874 404
23 3300042636 Ga0466703_012180 Ga0466703_012180_2041_3309 404
24 3300042648 Ga0466709_396735 Ga0466709_396735_654_1922 404
25 3300042594 Ga0466694_207609 Ga0466694_207609_10_1227 405
26 3300042648 Ga0466709_221860 Ga0466709_221860_17230_18498 405
27 3300042615 Ga0466711_022585 Ga0466711_022585_1603_2826 407
28 3300009826 Ga0123355_10484705 Ga0123355_104847051 408
29 3300042612 Ga0466705_436874 Ga0466705_436874_983_2254 409
30 3300038395 Ga0415639_131534 Ga0415639_131534_1427_2659 410
31 3300042592 Ga0466693_079380 Ga0466693_079380_676_1911 411
32 3300042592 Ga0466693_307240 Ga0466693_307240_3179_4414 411
33 3300042598 Ga0466701_057409 Ga0466701_057409_218_1504 411
34 3300042643 Ga0466704_554713 Ga0466704_554713_915_2186 411
35 iso_pr_bacteria 2940346213 2940346272 411
36 iso_pr_bacteria 2989309576 2989309731 411
37 3300042598 Ga0466701_098305 Ga0466701_098305_14938_16176 412
38 3300042635 Ga0466702_030919 Ga0466702_030919_11_1249 412
39 3300042654 Ga0466725_270282 Ga0466725_270282_666_1919 412
40 3300002462 JGI24702J35022_10081242 JGI24702J35022_100812421 413
41 3300010049 Ga0123356_10177800 Ga0123356_101778002 413
42 3300042599 Ga0466706_153622 Ga0466706_153622_318_1559 413
43 3300042608 Ga0466721_388772 Ga0466721_388772_234_1475 413
44 2225789004 2227631034 2228215234 414
45 3300005201 Ga0072941_1243424 Ga0072941_12434243 414
46 3300038395 Ga0415639_074974 Ga0415639_074974_1694_2938 414
47 3300042592 Ga0466693_124386 Ga0466693_124386_524_1768 414
48 3300042594 Ga0466694_341285 Ga0466694_341285_877_2121 414
49 3300042600 Ga0466700_090102 Ga0466700_090102_706_1950 414
50 3300042600 Ga0466700_211428 Ga0466700_211428_550_1794 414
51 3300042600 Ga0466700_231621 Ga0466700_231621_266_1510 414
52 3300042600 Ga0466700_323983 Ga0466700_323983_640_1884 414
53 3300042603 Ga0466714_030102 Ga0466714_030102_725_1969 414
54 3300042611 Ga0466697_025773 Ga0466697_025773_331_1575 414
55 3300042616 Ga0466715_279588 Ga0466715_279588_903_2147 414
56 3300042617 Ga0466718_075312 Ga0466718_075312_167_1411 414
57 3300042617 Ga0466718_122502 Ga0466718_122502_335_1579 414
58 3300042621 Ga0466729_194403 Ga0466729_194403_775_2019 414
59 3300042636 Ga0466703_417527 Ga0466703_417527_197_1441 414
60 3300042654 Ga0466725_138977 Ga0466725_138977_812_2056 414
61 3300042654 Ga0466725_239115 Ga0466725_239115_80_1324 414
62 3300042655 Ga0466727_280105 Ga0466727_280105_538_1824 414
63 3300042659 Ga0466733_207778 Ga0466733_207778_79_1323 414
64 3300056856 Ga0562375_0075 Ga0562375_0075_146336_147580 414
65 iso_pr_bacteria 2588253760 2588633375 414
66 iso_pr_bacteria 2910942425 2910944886 414
67 iso_pr_bacteria 2993991113 2993991251 414
68 iso_pr_bacteria 642555168 642695776 414
69 iso_pr_bacteria 642555168 642696538 414
70 iso_pr_bacteria 642979308 643188569 414
71 iso_pr_bacteria 642979308 643188938 414
72 3300002450 JGI24695J34938_10029735 JGI24695J34938_100297352 415
73 3300002462 JGI24702J35022_10017597 JGI24702J35022_100175975 415
74 3300002501 JGI24703J35330_11673238 JGI24703J35330_116732381 415
75 3300002504 JGI24705J35276_12213714 JGI24705J35276_122137141 415
76 3300005200 Ga0072940_1093091 Ga0072940_10930911 415
77 3300009784 Ga0123357_10080351 Ga0123357_100803512 415
78 3300009826 Ga0123355_10136296 Ga0123355_101362962 415
79 3300010049 Ga0123356_10194628 Ga0123356_101946282 415
80 3300010167 Ga0123353_10287535 Ga0123353_102875351 415
81 3300010882 Ga0123354_10154999 Ga0123354_101549991 415
82 3300042604 Ga0466717_084571 Ga0466717_084571_563_1810 415
83 3300042612 Ga0466705_006559 Ga0466705_006559_79_1326 415
84 iso_pr_bacteria 2896342394 2896343057 415
85 iso_pr_bacteria 2896342394 2896343396 415
86 iso_pr_bacteria 2896342394 2896343930 415
87 3300002732 WW0001_100179 WW0001_1001791 416
88 3300007139 Ga0103260_1005170 Ga0103260_10051703 416
89 3300042592 Ga0466693_350356 Ga0466693_350356_1372_2652 416
90 iso_pr_bacteria 2846025955 2846027807 416
91 3300007143 Ga0104048_1021570 Ga0104048_10215705 417
92 3300042654 Ga0466725_297744 Ga0466725_297744_469_1722 417
93 3300042615 Ga0466711_158449 Ga0466711_158449_372_1631 419
94 3300010049 Ga0123356_10141969 Ga0123356_101419692 420
95 3300010049 Ga0123356_10165490 Ga0123356_101654902 420
96 3300042600 Ga0466700_440813 Ga0466700_440813_666_1928 420
97 iso_pr_bacteria 2840666718 2840667363 420
98 iso_pr_bacteria 2840666718 2840667417 420
99 iso_pr_bacteria 2840666718 2840667490 420
100 iso_pr_bacteria 2840666718 2840667556 420
101 iso_pr_bacteria 2840666718 2840667704 420
102 iso_pr_bacteria 647533204 647539060 420
103 iso_pr_bacteria 647533204 647539138 420
104 iso_pr_bacteria 647533204 647540847 420
105 3300002508 JGI24700J35501_10930851 JGI24700J35501_109308511 421
106 2225789004 2227206095 2227633472 422
107 3300009784 Ga0123357_10202654 Ga0123357_102026542 422
108 3300042604 Ga0466717_012167 Ga0466717_012167_87_1355 422
109 3300042643 Ga0466704_384121 Ga0466704_384121_774_2042 422
110 3300042605 Ga0466716_281311 Ga0466716_281311_90_1361 423
111 3300042615 Ga0466711_453048 Ga0466711_453048_253_1524 423
112 3300042624 Ga0466735_173263 Ga0466735_173263_536_1807 423
113 iso_pr_bacteria 2896342394 2896342486 423
114 3300010167 Ga0123353_10317283 Ga0123353_103172831 424
115 3300038395 Ga0415639_082201 Ga0415639_082201_14_1288 424
116 3300042595 Ga0466695_191493 Ga0466695_191493_246_1520 424
117 3300042595 Ga0466695_278213 Ga0466695_278213_34_1308 424
118 3300010049 Ga0123356_10055473 Ga0123356_100554732 425
119 3300042636 Ga0466703_185270 Ga0466703_185270_1458_2753 425
120 3300002834 JGI24696J40584_12947911 JGI24696J40584_129479112 426
121 3300010167 Ga0123353_10289637 Ga0123353_102896371 426
122 3300042622 Ga0466731_141469 Ga0466731_141469_154_1434 426
123 3300042623 Ga0466734_072814 Ga0466734_072814_169_1449 426
124 3300042636 Ga0466703_408980 Ga0466703_408980_379_1659 426
125 3300042594 Ga0466694_142541 Ga0466694_142541_281_1564 427
126 3300042611 Ga0466697_147254 Ga0466697_147254_173_1456 427
127 3300010167 Ga0123353_10274617 Ga0123353_102746172 428
128 3300010167 Ga0123353_10414995 Ga0123353_104149952 428
129 3300042593 Ga0466691_002249 Ga0466691_002249_460_1746 428
130 3300042593 Ga0466691_045556 Ga0466691_045556_10806_12092 428
131 3300042609 Ga0466722_082567 Ga0466722_082567_564_1850 428
132 3300042610 Ga0466698_452719 Ga0466698_452719_407_1693 428
133 3300042611 Ga0466697_056626 Ga0466697_056626_565_1851 428
134 3300042612 Ga0466705_437945 Ga0466705_437945_879_2165 428
135 3300042622 Ga0466731_186676 Ga0466731_186676_689_1975 428
136 3300042611 Ga0466697_115914 Ga0466697_115914_1105_2394 429
137 3300038395 Ga0415639_186393 Ga0415639_186393_61_1353 430
138 3300042598 Ga0466701_089560 Ga0466701_089560_203_1495 430
139 3300042608 Ga0466721_118289 Ga0466721_118289_421_1713 430
140 3300042608 Ga0466721_291371 Ga0466721_291371_1092_2384 430
141 3300042613 Ga0466710_075814 Ga0466710_075814_286_1578 430
142 3300042622 Ga0466731_085208 Ga0466731_085208_137_1429 430
143 iso_pr_bacteria 2840666718 2840667571 430
144 2225789004 2227098058 2227480314 431
145 3300010049 Ga0123356_10049225 Ga0123356_100492253 431
146 3300010049 Ga0123356_10151727 Ga0123356_101517271 431
147 3300010882 Ga0123354_10168472 Ga0123354_101684721 431
148 3300042592 Ga0466693_254079 Ga0466693_254079_293_1588 431
149 3300042550 Ga0466656_258200 Ga0466656_258200_13343_14674 443
150 iso_pr_bacteria 2884843004 2884844518 443
151 3300042596 Ga0466696_020740 Ga0466696_020740_938_2299 453
152 iso_pr_bacteria 2884843004 2884843117 458
153 iso_pr_bacteria 2884843004 2884843131 458
154 iso_pr_bacteria 2884843004 2884843145 458
155 3300042606 Ga0466719_243777 Ga0466719_243777_622_2067 461
156 3300042611 Ga0466697_148765 Ga0466697_148765_183_1598 471

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 115 335 0.97
PF08388 GIIM Group II intron, maturase-specific domain 363 432 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.