Protein Family IF07002
Metagenome
Isolate
194
Members
65
Samples
174
Scaffolds
352.84
Avg Length
Representative Sequence
- ID
- 3300042611|Ga0466697_131549|Ga0466697_131549_137_1279
- Length
- 380 aa
- Sequence
- MMMIKPIINIISSIAAEPWWRVFYDFSSLTQAIDEGLRNLMPPFWAVAIELVIVGILFLTFYGVIGLVLVYIERKVCAFIQNRLGPNRIGPYGIFQTVADLVKLLFKELIPIKDSDKFLFNLAPYIIITINFMIVGALPFAKGLHAIDLNIGVFYIFAISSLNVVGVLLAGWASNSKYSLIGAMRSGAMMVSYELSLGLALITMIILAGSMQLSEIIEVQRGGWLIFRGHIPAFVAFIIYLISGTAETNRGPFDLAEAESELTAGYHTEYSGMKFAFFYLSEYINMFIVASIAAIIFLGGWMPLHIGSWDGFNRIMDWIPPIVWYFGKTFFVIYLIMMFKWTFPRLRIDQLLTLEWKYLLPINLINVLIMAFIVLMGWHF
Sample Types
Isolate
10.3%
Metagenome
89.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
22.2%
Termitidae
22.2%
Blattidae
19.0%
Unclassified
15.9%
Termopsidae
6.3%
Rhinotermitidae
4.8%
Passalidae
4.8%
Hodotermitidae
1.6%
Tenebrionidae
1.6%
Hydrophilidae
1.6%
Taxonomy
Archaea
0
Bacteria
182
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 2 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 10 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 22 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 23 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 24 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 27 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 30 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 31 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 32 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 38 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 39 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 46 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 47 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 48 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 49 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 50 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 53 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 54 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 55 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 56 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 57 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 58 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 59 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 60 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 61 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 62 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 63 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 64 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 65 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_411730 | 3300042601 | Unclassified | 1979 |
| 2 | Ga0466713_003852 | 3300042602 | Bacteria | 1350 |
| 3 | Ga0466722_098074 | 3300042609 | Bacteria | 7514 |
| 4 | Ga0466722_131066 | 3300042609 | Bacteria | 10030 |
| 5 | Ga0466698_364147 | 3300042610 | Bacteria | 1929 |
| 6 | Ga0466705_301679 | 3300042612 | Bacteria | 30952 |
| 7 | Ga0466715_104403 | 3300042616 | Bacteria | 11916 |
| 8 | Ga0466715_456601 | 3300042616 | Bacteria | 5089 |
| 9 | Ga0466690_294371 | 3300042590 | Bacteria | 12872 |
| 10 | Ga0466692_119983 | 3300042591 | Bacteria | 3225 |
| 11 | Ga0466701_014507 | 3300042598 | Bacteria | 3171 |
| 12 | Ga0466703_148416 | 3300042636 | Bacteria | 2204 |
| 13 | Ga0466703_175050 | 3300042636 | Bacteria | 4825 |
| 14 | Ga0466704_293428 | 3300042643 | Bacteria | 4205 |
| 15 | Ga0466709_245110 | 3300042648 | Bacteria | 22256 |
| 16 | Ga0466708_290083 | 3300042652 | Bacteria | 3901 |
| 17 | Ga0466733_203605 | 3300042659 | Bacteria | 93930 |
| 18 | Ga0466701_098080 | 3300042598 | Bacteria | 65896 |
| 19 | Ga0466707_062128 | 3300042601 | Bacteria | 19135 |
| 20 | Ga0466707_299100 | 3300042601 | Bacteria | 1380 |
| 21 | Ga0466722_070620 | 3300042609 | Bacteria | 4907 |
| 22 | Ga0466697_101391 | 3300042611 | Bacteria | 1453 |
| 23 | Ga0466728_021718 | 3300042620 | Bacteria | 3405 |
| 24 | IMNBL1DRAFT_c0008088 | 3300000062 | Bacteria | 5411 |
| 25 | IMNBL1DRAFT_c0033748 | 3300000062 | Bacteria | 1829 |
| 26 | Ga0068305_10037095 | 3300005083 | Bacteria | 5251 |
| 27 | Ga0466690_101280 | 3300042590 | Bacteria | 4655 |
| 28 | Ga0466692_102850 | 3300042591 | Bacteria | 14012 |
| 29 | Ga0466693_063245 | 3300042592 | Bacteria | 3291 |
| 30 | Ga0466696_175794 | 3300042596 | Bacteria | 2186 |
| 31 | Ga0466731_010142 | 3300042622 | Bacteria | 2040 |
| 32 | Ga0466703_140271 | 3300042636 | Bacteria | 55996 |
| 33 | Ga0466704_142594 | 3300042643 | Bacteria | 6642 |
| 34 | Ga0466704_251741 | 3300042643 | Bacteria | 19766 |
| 35 | Ga0466706_109799 | 3300042599 | Bacteria | 205088 |
| 36 | Ga0466707_191673 | 3300042601 | Bacteria | 8925 |
| 37 | Ga0466716_442880 | 3300042605 | Bacteria | 8188 |
| 38 | Ga0466719_028262 | 3300042606 | Bacteria | 7946 |
| 39 | Ga0123357_10400818 | 3300009784 | Bacteria | 1249 |
| 40 | Ga0123356_10544455 | 3300010049 | Unclassified | 1321 |
| 41 | Ga0123353_10073829 | 3300010167 | Bacteria | 5483 |
| 42 | Ga0466705_032844 | 3300042612 | Bacteria | 18355 |
| 43 | Ga0466715_021583 | 3300042616 | Unclassified | 4112 |
| 44 | Ga0466715_285909 | 3300042616 | Bacteria | 8932 |
| 45 | Ga0466723_014215 | 3300042618 | Bacteria | 13889 |
| 46 | Ga0466726_161990 | 3300042619 | Bacteria | 1322 |
| 47 | Ga0265387_1003798 | 3300024582 | Bacteria | 2076 |
| 48 | Ga0466696_305629 | 3300042596 | Bacteria | 12685 |
| 49 | Ga0466735_101884 | 3300042624 | Bacteria | 3918 |
| 50 | Ga0466709_231759 | 3300042648 | Bacteria | 5441 |
| 51 | Ga0466725_124439 | 3300042654 | Bacteria | 1350 |
| 52 | Ga0466733_006535 | 3300042659 | Bacteria | 7369 |
| 53 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 54 | Ga0466707_358506 | 3300042601 | Bacteria | 2198 |
| 55 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 56 | Ga0466714_010843 | 3300042603 | Bacteria | 1267 |
| 57 | Ga0466714_061841 | 3300042603 | Bacteria | 10327 |
| 58 | Ga0466714_150199 | 3300042603 | Bacteria | 149649 |
| 59 | Ga0466719_280712 | 3300042606 | Unclassified | 3118 |
| 60 | Ga0466698_072502 | 3300042610 | Bacteria | 1285 |
| 61 | Ga0123357_10015964 | 3300009784 | Bacteria | 9862 |
| 62 | Ga0123356_10431720 | 3300010049 | Bacteria | 1462 |
| 63 | Ga0466711_172329 | 3300042615 | Bacteria | 9572 |
| 64 | Ga0466715_240109 | 3300042616 | Bacteria | 17583 |
| 65 | Ga0466726_098008 | 3300042619 | Bacteria | 12087 |
| 66 | Ga0466726_101376 | 3300042619 | Bacteria | 1477 |
| 67 | Ga0466729_069107 | 3300042621 | Bacteria | 4160 |
| 68 | 2227065531 | 2225789003 | Unclassified | 3379 |
| 69 | Ga0123357_10001945 | 3300009784 | Bacteria | 22544 |
| 70 | Ga0466690_149899 | 3300042590 | Bacteria | 20818 |
| 71 | Ga0466691_023853 | 3300042593 | Bacteria | 11971 |
| 72 | Ga0466731_137472 | 3300042622 | Bacteria | 1479 |
| 73 | Ga0466703_203837 | 3300042636 | Bacteria | 13462 |
| 74 | Ga0466704_186597 | 3300042643 | Bacteria | 3823 |
| 75 | Ga0466709_410544 | 3300042648 | Unclassified | 4433 |
| 76 | Ga0466709_414483 | 3300042648 | Bacteria | 24643 |
| 77 | Ga0466732_114982 | 3300042656 | Bacteria | 2404 |
| 78 | Ga0466707_242775 | 3300042601 | Bacteria | 11468 |
| 79 | Ga0466713_123016 | 3300042602 | Bacteria | 2509 |
| 80 | Ga0466714_091668 | 3300042603 | Bacteria | 24422 |
| 81 | Ga0466716_539568 | 3300042605 | Bacteria | 9234 |
| 82 | Ga0466719_012506 | 3300042606 | Bacteria | 11641 |
| 83 | Ga0466719_547111 | 3300042606 | Bacteria | 8384 |
| 84 | Ga0466722_230937 | 3300042609 | Bacteria | 5155 |
| 85 | Ga0123356_10331477 | 3300010049 | Bacteria | 1639 |
| 86 | Ga0123353_10777884 | 3300010167 | Bacteria | 1326 |
| 87 | Ga0466697_159345 | 3300042611 | Bacteria | 1542 |
| 88 | Ga0466705_061319 | 3300042612 | Bacteria | 5992 |
| 89 | Ga0466705_156124 | 3300042612 | Bacteria | 9397 |
| 90 | Ga0466711_112728 | 3300042615 | Bacteria | 2006 |
| 91 | Ga0466711_288114 | 3300042615 | Bacteria | 3449 |
| 92 | IMNBL1DRAFT_c0001104 | 3300000062 | Bacteria | 20698 |
| 93 | Ga0068302_10253998 | 3300005071 | Bacteria | 3233 |
| 94 | Ga0466692_183944 | 3300042591 | Bacteria | 13311 |
| 95 | Ga0466691_151363 | 3300042593 | Bacteria | 11991 |
| 96 | Ga0466696_208928 | 3300042596 | Unclassified | 1645 |
| 97 | Ga0466735_012272 | 3300042624 | Bacteria | 13363 |
| 98 | Ga0466735_178283 | 3300042624 | Bacteria | 4947 |
| 99 | Ga0466735_198081 | 3300042624 | Unclassified | 3180 |
| 100 | Ga0466735_231342 | 3300042624 | Bacteria | 4048 |
| 101 | Ga0466704_096642 | 3300042643 | Bacteria | 11632 |
| 102 | Ga0466704_193235 | 3300042643 | Bacteria | 11221 |
| 103 | Ga0466733_029228 | 3300042659 | Bacteria | 8355 |
| 104 | Ga0466733_175419 | 3300042659 | Bacteria | 32803 |
| 105 | Ga0466713_037944 | 3300042602 | Bacteria | 60611 |
| 106 | Ga0466713_135454 | 3300042602 | Bacteria | 2447 |
| 107 | Ga0466714_011714 | 3300042603 | Bacteria | 47582 |
| 108 | Ga0466714_051125 | 3300042603 | Bacteria | 52861 |
| 109 | Ga0466716_035678 | 3300042605 | Bacteria | 3569 |
| 110 | Ga0466716_067660 | 3300042605 | Bacteria | 6394 |
| 111 | Ga0466716_371367 | 3300042605 | Bacteria | 12791 |
| 112 | Ga0466722_113613 | 3300042609 | Bacteria | 129604 |
| 113 | Ga0466705_051958 | 3300042612 | Bacteria | 7798 |
| 114 | Ga0466705_073835 | 3300042612 | Bacteria | 13642 |
| 115 | Ga0466723_087959 | 3300042618 | Bacteria | 5565 |
| 116 | Ga0466723_092051 | 3300042618 | Bacteria | 16294 |
| 117 | Ga0466657_005889 | 3300042582 | Bacteria | 2059 |
| 118 | Ga0466735_081564 | 3300042624 | Bacteria | 3812 |
| 119 | Ga0466730_038219 | 3300042625 | Bacteria | 3031 |
| 120 | Ga0466704_082750 | 3300042643 | Bacteria | 26962 |
| 121 | Ga0466704_575107 | 3300042643 | Bacteria | 3761 |
| 122 | Ga0466732_005715 | 3300042656 | Bacteria | 91596 |
| 123 | Ga0466733_054986 | 3300042659 | Bacteria | 147644 |
| 124 | Ga0466733_086622 | 3300042659 | Bacteria | 4394 |
| 125 | Ga0466706_132256 | 3300042599 | Bacteria | 31081 |
| 126 | Ga0466707_068270 | 3300042601 | Bacteria | 10493 |
| 127 | Ga0466707_115094 | 3300042601 | Bacteria | 2117 |
| 128 | Ga0466713_027728 | 3300042602 | Bacteria | 12610 |
| 129 | Ga0466713_103961 | 3300042602 | Bacteria | 6433 |
| 130 | Ga0466719_221389 | 3300042606 | Bacteria | 6422 |
| 131 | Ga0466697_131549 | 3300042611 | Bacteria | 1676 |
| 132 | Ga0466705_335658 | 3300042612 | Bacteria | 24109 |
| 133 | Ga0466705_350955 | 3300042612 | Bacteria | 6058 |
| 134 | Ga0466715_023105 | 3300042616 | Bacteria | 7276 |
| 135 | Ga0466715_063088 | 3300042616 | Unclassified | 7672 |
| 136 | Ga0466715_403844 | 3300042616 | Bacteria | 18417 |
| 137 | Ga0466723_094954 | 3300042618 | Bacteria | 8294 |
| 138 | 2227591289 | 2225789004 | Bacteria | 12992 |
| 139 | IMNBL1DRAFT_c0001921 | 3300000062 | Bacteria | 15041 |
| 140 | Ga0072941_1402549 | 3300005201 | Bacteria | 1308 |
| 141 | Ga0466690_005110 | 3300042590 | Bacteria | 14539 |
| 142 | Ga0466692_192614 | 3300042591 | Bacteria | 3161 |
| 143 | Ga0466696_261686 | 3300042596 | Bacteria | 3964 |
| 144 | Ga0466735_100070 | 3300042624 | Bacteria | 6650 |
| 145 | Ga0466704_572231 | 3300042643 | Bacteria | 2184 |
| 146 | Ga0466708_049839 | 3300042652 | Bacteria | 17940 |
| 147 | Ga0466725_210063 | 3300042654 | Bacteria | 11666 |
| 148 | Ga0466727_035085 | 3300042655 | Unclassified | 1184 |
| 149 | Ga0466727_104023 | 3300042655 | Bacteria | 4393 |
| 150 | Ga0466733_130577 | 3300042659 | Bacteria | 17591 |
| 151 | Ga0466733_180918 | 3300042659 | Bacteria | 6230 |
| 152 | Ga0466707_127336 | 3300042601 | Bacteria | 4598 |
| 153 | Ga0466707_327841 | 3300042601 | Bacteria | 9241 |
| 154 | Ga0466713_010310 | 3300042602 | Bacteria | 41924 |
| 155 | Ga0466719_104508 | 3300042606 | Bacteria | 2465 |
| 156 | Ga0466719_319955 | 3300042606 | Bacteria | 5163 |
| 157 | Ga0123356_10015974 | 3300010049 | Bacteria | 7177 |
| 158 | Ga0466715_008476 | 3300042616 | Bacteria | 2420 |
| 159 | Ga0466726_160354 | 3300042619 | Bacteria | 5014 |
| 160 | Ga0466726_214054 | 3300042619 | Bacteria | 1745 |
| 161 | Ga0466726_280553 | 3300042619 | Bacteria | 8250 |
| 162 | Ga0466729_096704 | 3300042621 | Bacteria | 15068 |
| 163 | 2227644078 | 2225789004 | Bacteria | 2041 |
| 164 | IMNBL1DRAFT_c0001469 | 3300000062 | Bacteria | 17624 |
| 165 | IMNBL1DRAFT_c0048563 | 3300000062 | Unclassified | 1360 |
| 166 | Ga0068305_10252352 | 3300005083 | Bacteria | 2159 |
| 167 | Ga0466690_003078 | 3300042590 | Bacteria | 25930 |
| 168 | Ga0466690_130397 | 3300042590 | Unclassified | 4188 |
| 169 | Ga0466691_006239 | 3300042593 | Bacteria | 10188 |
| 170 | Ga0466696_026812 | 3300042596 | Bacteria | 27611 |
| 171 | Ga0466735_110297 | 3300042624 | Bacteria | 8315 |
| 172 | Ga0466703_305494 | 3300042636 | Bacteria | 3038 |
| 173 | Ga0466704_602482 | 3300042643 | Bacteria | 52119 |
| 174 | Ga0466727_000612 | 3300042655 | Bacteria | 11085 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00146 | NADHdh | NADH dehydrogenase | 56 | 371 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00146 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.